data_2P2E # _entry.id 2P2E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2P2E RCSB RCSB041880 WWPDB D_1000041880 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-10399l _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2P2E _pdbx_database_status.recvd_initial_deposition_date 2007-03-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Agarwal, R.' 1 ? 'Burley, S.K.' 2 0000-0002-2487-9713 'Swaminathan, S.' 3 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 4 ? # _citation.id primary _citation.title 'Crystal structure of a putative Fe-S biosynthesis protein from Lactobacillus salivarius with novel protein fold' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Agarwal, R.' 1 ? primary 'Burley, S.K.' 2 0000-0002-2487-9713 primary 'Swaminathan, S.' 3 ? # _cell.entry_id 2P2E _cell.length_a 94.577 _cell.length_b 94.577 _cell.length_c 36.854 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2P2E _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative Fe-S biosynthesis protein' 14826.751 1 ? ? ? ? 2 water nat water 18.015 30 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Putative Fe-S cluster assembly protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLKITVTDDAAKKLQRYTDDSNAVLLLDFDDGVGALSKVGVCSLNSDFRILVVSKD(MSE)DYKKDYNEVIDSNI GKFYYKGYSK(MSE)Y(MSE)DDN(MSE)KISLNTNNSLLRLTGDNSGEL(MSE)PALSIQDFREGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLKITVTDDAAKKLQRYTDDSNAVLLLDFDDGVGALSKVGVCSLNSDFRILVVSKDMDYKKDYNEVIDSNIGKFYYKGY SKMYMDDNMKISLNTNNSLLRLTGDNSGELMPALSIQDFREGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-10399l # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 LYS n 1 5 ILE n 1 6 THR n 1 7 VAL n 1 8 THR n 1 9 ASP n 1 10 ASP n 1 11 ALA n 1 12 ALA n 1 13 LYS n 1 14 LYS n 1 15 LEU n 1 16 GLN n 1 17 ARG n 1 18 TYR n 1 19 THR n 1 20 ASP n 1 21 ASP n 1 22 SER n 1 23 ASN n 1 24 ALA n 1 25 VAL n 1 26 LEU n 1 27 LEU n 1 28 LEU n 1 29 ASP n 1 30 PHE n 1 31 ASP n 1 32 ASP n 1 33 GLY n 1 34 VAL n 1 35 GLY n 1 36 ALA n 1 37 LEU n 1 38 SER n 1 39 LYS n 1 40 VAL n 1 41 GLY n 1 42 VAL n 1 43 CYS n 1 44 SER n 1 45 LEU n 1 46 ASN n 1 47 SER n 1 48 ASP n 1 49 PHE n 1 50 ARG n 1 51 ILE n 1 52 LEU n 1 53 VAL n 1 54 VAL n 1 55 SER n 1 56 LYS n 1 57 ASP n 1 58 MSE n 1 59 ASP n 1 60 TYR n 1 61 LYS n 1 62 LYS n 1 63 ASP n 1 64 TYR n 1 65 ASN n 1 66 GLU n 1 67 VAL n 1 68 ILE n 1 69 ASP n 1 70 SER n 1 71 ASN n 1 72 ILE n 1 73 GLY n 1 74 LYS n 1 75 PHE n 1 76 TYR n 1 77 TYR n 1 78 LYS n 1 79 GLY n 1 80 TYR n 1 81 SER n 1 82 LYS n 1 83 MSE n 1 84 TYR n 1 85 MSE n 1 86 ASP n 1 87 ASP n 1 88 ASN n 1 89 MSE n 1 90 LYS n 1 91 ILE n 1 92 SER n 1 93 LEU n 1 94 ASN n 1 95 THR n 1 96 ASN n 1 97 ASN n 1 98 SER n 1 99 LEU n 1 100 LEU n 1 101 ARG n 1 102 LEU n 1 103 THR n 1 104 GLY n 1 105 ASP n 1 106 ASN n 1 107 SER n 1 108 GLY n 1 109 GLU n 1 110 LEU n 1 111 MSE n 1 112 PRO n 1 113 ALA n 1 114 LEU n 1 115 SER n 1 116 ILE n 1 117 GLN n 1 118 ASP n 1 119 PHE n 1 120 ARG n 1 121 GLU n 1 122 GLY n 1 123 HIS n 1 124 HIS n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Lactobacillus _entity_src_gen.pdbx_gene_src_gene LSL_1730 _entity_src_gen.gene_src_species 'Lactobacillus salivarius' _entity_src_gen.gene_src_strain UCC118 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus salivarius' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 362948 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)codon+RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PSGX3(BC)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q1WRG6_LACS1 _struct_ref.pdbx_db_accession Q1WRG6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KITVTDDAAKKLQRYTDDSNAVLLLDFDDGVGALSKVGVCSLNSDFRILVVSKDMDYKKDYNEVIDSNIGKFYYKGYSKM YMDDNMKISLNTNNSLLRLTGDNSGELMPALSIQDFR ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2P2E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q1WRG6 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 118 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 120 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2P2E MSE A 1 ? UNP Q1WRG6 ? ? 'cloning artifact' 1 1 1 2P2E SER A 2 ? UNP Q1WRG6 ? ? 'cloning artifact' 2 2 1 2P2E LEU A 3 ? UNP Q1WRG6 ? ? 'cloning artifact' 3 3 1 2P2E MSE A 58 ? UNP Q1WRG6 MET 56 'modified residue' 58 4 1 2P2E MSE A 83 ? UNP Q1WRG6 MET 81 'modified residue' 83 5 1 2P2E MSE A 85 ? UNP Q1WRG6 MET 83 'modified residue' 85 6 1 2P2E MSE A 89 ? UNP Q1WRG6 MET 87 'modified residue' 89 7 1 2P2E MSE A 111 ? UNP Q1WRG6 MET 109 'modified residue' 111 8 1 2P2E GLU A 121 ? UNP Q1WRG6 ? ? 'cloning artifact' 121 9 1 2P2E GLY A 122 ? UNP Q1WRG6 ? ? 'cloning artifact' 122 10 1 2P2E HIS A 123 ? UNP Q1WRG6 ? ? 'cloning artifact' 123 11 1 2P2E HIS A 124 ? UNP Q1WRG6 ? ? 'cloning artifact' 124 12 1 2P2E HIS A 125 ? UNP Q1WRG6 ? ? 'cloning artifact' 125 13 1 2P2E HIS A 126 ? UNP Q1WRG6 ? ? 'cloning artifact' 126 14 1 2P2E HIS A 127 ? UNP Q1WRG6 ? ? 'cloning artifact' 127 15 1 2P2E HIS A 128 ? UNP Q1WRG6 ? ? 'cloning artifact' 128 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2P2E _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.21 _exptl_crystal.density_percent_sol 61.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 278 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details '0.1M Ammonium acetate, 0.1M Sodium acetate, 25% PEG 4000, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 278K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2007-03-02 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Si-III _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97920 # _reflns.entry_id 2P2E _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.48 _reflns.number_obs 6368 _reflns.number_all 6368 _reflns.percent_possible_obs 91.8 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.6 _reflns.B_iso_Wilson_estimate 30.1 _reflns.pdbx_redundancy 16.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.48 _reflns_shell.d_res_low 2.57 _reflns_shell.percent_possible_all 52.1 _reflns_shell.Rmerge_I_obs 0.34 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.pdbx_redundancy 3 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 352 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2P2E _refine.ls_number_reflns_obs 6133 _refine.ls_number_reflns_all 6133 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 45461.85 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.29 _refine.ls_d_res_high 2.48 _refine.ls_percent_reflns_obs 88.6 _refine.ls_R_factor_obs 0.229 _refine.ls_R_factor_all 0.229 _refine.ls_R_factor_R_work 0.229 _refine.ls_R_factor_R_free 0.273 _refine.ls_R_factor_R_free_error 0.019 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 3.2 _refine.ls_number_reflns_R_free 198 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 28.1 _refine.aniso_B[1][1] 0.62 _refine.aniso_B[2][2] 0.62 _refine.aniso_B[3][3] -1.23 _refine.aniso_B[1][2] 4.15 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.366131 _refine.solvent_model_param_bsol 31.4843 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2P2E _refine_analyze.Luzzati_coordinate_error_obs 0.32 _refine_analyze.Luzzati_sigma_a_obs 0.34 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.35 _refine_analyze.Luzzati_sigma_a_free 0.31 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 939 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 969 _refine_hist.d_res_high 2.48 _refine_hist.d_res_low 47.29 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.9 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.64 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.48 _refine_ls_shell.d_res_low 2.64 _refine_ls_shell.number_reflns_R_work 594 _refine_ls_shell.R_factor_R_work 0.308 _refine_ls_shell.percent_reflns_obs 54.1 _refine_ls_shell.R_factor_R_free 0.327 _refine_ls_shell.R_factor_R_free_error 0.068 _refine_ls_shell.percent_reflns_R_free 3.7 _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 ion.param ? 'X-RAY DIFFRACTION' 3 water_rep.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 2P2E _struct.title 'Crystal structure of a putative Fe-S biosynthesis protein from Lactobacillus salivarius with novel protein fold' _struct.pdbx_descriptor 'Putative Fe-S biosynthesis protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2P2E _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;hypothetical protein, beta-barrel, Fe-S biosynthesis, 10399l, Structural Genomics, Protein Structure Initiative, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 8 ? ASP A 20 ? THR A 8 ASP A 20 1 ? 13 HELX_P HELX_P2 2 GLY A 35 ? VAL A 40 ? GLY A 35 VAL A 40 5 ? 6 HELX_P HELX_P3 3 LYS A 78 ? MSE A 85 ? LYS A 78 MSE A 85 5 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 57 C ? ? ? 1_555 A MSE 58 N ? ? A ASP 57 A MSE 58 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A MSE 58 C ? ? ? 1_555 A ASP 59 N ? ? A MSE 58 A ASP 59 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale3 covale both ? A LYS 82 C ? ? ? 1_555 A MSE 83 N ? ? A LYS 82 A MSE 83 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? A MSE 83 C ? ? ? 1_555 A TYR 84 N ? ? A MSE 83 A TYR 84 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A TYR 84 C ? ? ? 1_555 A MSE 85 N ? ? A TYR 84 A MSE 85 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale6 covale both ? A MSE 85 C ? ? ? 1_555 A ASP 86 N ? ? A MSE 85 A ASP 86 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale7 covale both ? A ASN 88 C ? ? ? 1_555 A MSE 89 N ? ? A ASN 88 A MSE 89 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale8 covale both ? A MSE 89 C ? ? ? 1_555 A LYS 90 N ? ? A MSE 89 A LYS 90 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale9 covale both ? A LEU 110 C ? ? ? 1_555 A MSE 111 N ? ? A LEU 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale10 covale both ? A MSE 111 C ? ? ? 1_555 A PRO 112 N ? ? A MSE 111 A PRO 112 1_555 ? ? ? ? ? ? ? 1.336 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? anti-parallel A 6 7 ? parallel A 7 8 ? anti-parallel A 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 108 ? LEU A 114 ? GLY A 108 LEU A 114 A 2 LEU A 100 ? GLY A 104 ? LEU A 100 GLY A 104 A 3 ASN A 88 ? LEU A 93 ? ASN A 88 LEU A 93 A 4 LYS A 4 ? VAL A 7 ? LYS A 4 VAL A 7 A 5 GLU A 66 ? SER A 70 ? GLU A 66 SER A 70 A 6 PHE A 75 ? TYR A 77 ? PHE A 75 TYR A 77 A 7 ALA A 24 ? PHE A 30 ? ALA A 24 PHE A 30 A 8 PHE A 49 ? SER A 55 ? PHE A 49 SER A 55 A 9 ILE A 116 ? ASP A 118 ? ILE A 116 ASP A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 114 ? O LEU A 114 N LEU A 100 ? N LEU A 100 A 2 3 O THR A 103 ? O THR A 103 N LYS A 90 ? N LYS A 90 A 3 4 O MSE A 89 ? O MSE A 89 N LYS A 4 ? N LYS A 4 A 4 5 N ILE A 5 ? N ILE A 5 O ASP A 69 ? O ASP A 69 A 5 6 N ILE A 68 ? N ILE A 68 O PHE A 75 ? O PHE A 75 A 6 7 O TYR A 76 ? O TYR A 76 N LEU A 26 ? N LEU A 26 A 7 8 N LEU A 27 ? N LEU A 27 O LEU A 52 ? O LEU A 52 A 8 9 N ILE A 51 ? N ILE A 51 O GLN A 117 ? O GLN A 117 # _database_PDB_matrix.entry_id 2P2E _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2P2E _atom_sites.fract_transf_matrix[1][1] 0.010573 _atom_sites.fract_transf_matrix[1][2] 0.006105 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012209 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027134 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 MSE 58 58 58 MSE MSE A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 MSE 83 83 83 MSE MSE A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 MSE 85 85 85 MSE MSE A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 MSE 89 89 89 MSE MSE A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 MSE 111 111 111 MSE MSE A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 GLY 122 122 ? ? ? A . n A 1 123 HIS 123 123 ? ? ? A . n A 1 124 HIS 124 124 ? ? ? A . n A 1 125 HIS 125 125 ? ? ? A . n A 1 126 HIS 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 HIS 128 128 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 129 1 HOH TIP A . B 2 HOH 2 130 2 HOH TIP A . B 2 HOH 3 131 3 HOH TIP A . B 2 HOH 4 132 4 HOH TIP A . B 2 HOH 5 133 5 HOH TIP A . B 2 HOH 6 134 6 HOH TIP A . B 2 HOH 7 135 7 HOH TIP A . B 2 HOH 8 136 8 HOH TIP A . B 2 HOH 9 137 9 HOH TIP A . B 2 HOH 10 138 10 HOH TIP A . B 2 HOH 11 139 11 HOH TIP A . B 2 HOH 12 140 12 HOH TIP A . B 2 HOH 13 141 13 HOH TIP A . B 2 HOH 14 142 15 HOH TIP A . B 2 HOH 15 143 16 HOH TIP A . B 2 HOH 16 144 18 HOH TIP A . B 2 HOH 17 145 19 HOH TIP A . B 2 HOH 18 146 20 HOH TIP A . B 2 HOH 19 147 29 HOH TIP A . B 2 HOH 20 148 30 HOH TIP A . B 2 HOH 21 149 31 HOH TIP A . B 2 HOH 22 150 32 HOH TIP A . B 2 HOH 23 151 34 HOH TIP A . B 2 HOH 24 152 39 HOH TIP A . B 2 HOH 25 153 42 HOH TIP A . B 2 HOH 26 154 43 HOH TIP A . B 2 HOH 27 155 44 HOH TIP A . B 2 HOH 28 156 45 HOH TIP A . B 2 HOH 29 157 56 HOH TIP A . B 2 HOH 30 158 66 HOH TIP A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 58 A MSE 58 ? MET SELENOMETHIONINE 2 A MSE 83 A MSE 83 ? MET SELENOMETHIONINE 3 A MSE 85 A MSE 85 ? MET SELENOMETHIONINE 4 A MSE 89 A MSE 89 ? MET SELENOMETHIONINE 5 A MSE 111 A MSE 111 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-03-20 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 4 'Structure model' citation_author 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_citation_author.identifier_ORCID' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 CBASS 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SHELXD phasing . ? 5 SHARP phasing . ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 31 ? ? -69.23 85.29 2 1 VAL A 42 ? ? -47.60 152.49 3 1 LEU A 45 ? ? -65.75 47.21 4 1 LYS A 56 ? ? -66.83 1.41 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A GLY 122 ? A GLY 122 4 1 Y 1 A HIS 123 ? A HIS 123 5 1 Y 1 A HIS 124 ? A HIS 124 6 1 Y 1 A HIS 125 ? A HIS 125 7 1 Y 1 A HIS 126 ? A HIS 126 8 1 Y 1 A HIS 127 ? A HIS 127 9 1 Y 1 A HIS 128 ? A HIS 128 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #