data_2P6Y # _entry.id 2P6Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2P6Y RCSB RCSB042043 WWPDB D_1000042043 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB VcR80 . unspecified PDB 2NMU 'High homology. Crystal structure of hypothetical protein from Salmonella typhimurium LT2. NESG target StR127' unspecified PDB 2HX0 'High homology. Three-dimensional structure of hypothetical protein from Salmonella cholerae-suis. NESG target ScR59' unspecified PDB 2H6L 'High homology. X-ray structure of metal containing hypothetical protein AF0104 from Archaeoglobus fulgidus. NESG target GR103' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2P6Y _pdbx_database_status.recvd_initial_deposition_date 2007-03-19 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kuzin, A.P.' 1 'Abashidze, M.' 2 'Jayaraman, S.' 3 'Chen, C.X.' 4 'Wang, C.' 5 'Fang, Y.' 6 'Cunningham, K.' 7 'Owens, L.' 8 'Xiao, R.' 9 'Liu, J.' 10 'Baran, M.C.' 11 'Acton, T.B.' 12 'Rost, B.' 13 'Montelione, G.T.' 14 'Tong, L.' 15 'Hunt, J.' 16 'Northeast Structural Genomics Consortium (NESG)' 17 # _citation.id primary _citation.title 'X-ray structure of the protein Q9KM02_VIBCH from Vibrio cholerae at the resolution 1.63 A.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kuzin, A.P.' 1 primary 'Abashidze, M.' 2 primary 'Jayaraman, S.' 3 primary 'Chen, C.X.' 4 primary 'Wang, C.' 5 primary 'Fang, Y.' 6 primary 'Cunningham, K.' 7 primary 'Owens, L.' 8 primary 'Xiao, R.' 9 primary 'Liu, J.' 10 primary 'Baran, M.C.' 11 primary 'Acton, T.B.' 12 primary 'Rost, B.' 13 primary 'Montelione, G.T.' 14 primary 'Tong, L.' 15 primary 'Hunt, J.' 16 # _cell.entry_id 2P6Y _cell.length_a 172.924 _cell.length_b 172.924 _cell.length_c 172.924 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 96 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2P6Y _symmetry.space_group_name_H-M 'F 4 3 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 209 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein VCA0587' 16018.817 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 146 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)IHLIALRLTRG(MSE)DLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQ HCHLHIAVADAQGRVWGGHLLEGNLINTTAEL(MSE)IHHYPQHHFTREFDPNTGYSELVVSAAALEHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MIHLIALRLTRGMDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQHCHLHIAV ADAQGRVWGGHLLEGNLINTTAELMIHHYPQHHFTREFDPNTGYSELVVSAAALEHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier VcR80 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ILE n 1 3 HIS n 1 4 LEU n 1 5 ILE n 1 6 ALA n 1 7 LEU n 1 8 ARG n 1 9 LEU n 1 10 THR n 1 11 ARG n 1 12 GLY n 1 13 MSE n 1 14 ASP n 1 15 LEU n 1 16 LYS n 1 17 GLN n 1 18 GLN n 1 19 ILE n 1 20 VAL n 1 21 GLN n 1 22 LEU n 1 23 VAL n 1 24 GLN n 1 25 GLN n 1 26 HIS n 1 27 ARG n 1 28 ILE n 1 29 HIS n 1 30 ALA n 1 31 GLY n 1 32 SER n 1 33 ILE n 1 34 ALA n 1 35 SER n 1 36 CYS n 1 37 VAL n 1 38 GLY n 1 39 CYS n 1 40 LEU n 1 41 SER n 1 42 THR n 1 43 LEU n 1 44 HIS n 1 45 ILE n 1 46 ARG n 1 47 LEU n 1 48 ALA n 1 49 ASP n 1 50 SER n 1 51 VAL n 1 52 SER n 1 53 THR n 1 54 LEU n 1 55 GLN n 1 56 VAL n 1 57 SER n 1 58 ALA n 1 59 PRO n 1 60 PHE n 1 61 GLU n 1 62 ILE n 1 63 LEU n 1 64 SER n 1 65 LEU n 1 66 SER n 1 67 GLY n 1 68 THR n 1 69 LEU n 1 70 THR n 1 71 TYR n 1 72 GLN n 1 73 HIS n 1 74 CYS n 1 75 HIS n 1 76 LEU n 1 77 HIS n 1 78 ILE n 1 79 ALA n 1 80 VAL n 1 81 ALA n 1 82 ASP n 1 83 ALA n 1 84 GLN n 1 85 GLY n 1 86 ARG n 1 87 VAL n 1 88 TRP n 1 89 GLY n 1 90 GLY n 1 91 HIS n 1 92 LEU n 1 93 LEU n 1 94 GLU n 1 95 GLY n 1 96 ASN n 1 97 LEU n 1 98 ILE n 1 99 ASN n 1 100 THR n 1 101 THR n 1 102 ALA n 1 103 GLU n 1 104 LEU n 1 105 MSE n 1 106 ILE n 1 107 HIS n 1 108 HIS n 1 109 TYR n 1 110 PRO n 1 111 GLN n 1 112 HIS n 1 113 HIS n 1 114 PHE n 1 115 THR n 1 116 ARG n 1 117 GLU n 1 118 PHE n 1 119 ASP n 1 120 PRO n 1 121 ASN n 1 122 THR n 1 123 GLY n 1 124 TYR n 1 125 SER n 1 126 GLU n 1 127 LEU n 1 128 VAL n 1 129 VAL n 1 130 SER n 1 131 ALA n 1 132 ALA n 1 133 ALA n 1 134 LEU n 1 135 GLU n 1 136 HIS n 1 137 HIS n 1 138 HIS n 1 139 HIS n 1 140 HIS n 1 141 HIS n 1 142 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Vibrio _entity_src_gen.pdbx_gene_src_gene VCA0587 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'El Tor Inaba N16961' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio cholerae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 666 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 39315 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9KM02_VIBCH _struct_ref.pdbx_db_accession Q9KM02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIHLIALRLTRGMDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQHCHLHIAV ADAQGRVWGGHLLEGNLINTTAELMIHHYPQHHFTREFDPNTGYSELVVS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2P6Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 130 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9KM02 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 130 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2P6Y MSE A 1 ? UNP Q9KM02 MET 1 'MODIFIED RESIDUE' 1 1 1 2P6Y MSE A 13 ? UNP Q9KM02 MET 13 'MODIFIED RESIDUE' 13 2 1 2P6Y MSE A 105 ? UNP Q9KM02 MET 105 'MODIFIED RESIDUE' 105 3 1 2P6Y ALA A 131 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 131 4 1 2P6Y ALA A 132 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 132 5 1 2P6Y ALA A 133 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 133 6 1 2P6Y LEU A 134 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 134 7 1 2P6Y GLU A 135 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 135 8 1 2P6Y HIS A 136 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 136 9 1 2P6Y HIS A 137 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 137 10 1 2P6Y HIS A 138 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 138 11 1 2P6Y HIS A 139 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 139 12 1 2P6Y HIS A 140 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 140 13 1 2P6Y HIS A 141 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 141 14 1 2P6Y HIS A 142 ? UNP Q9KM02 ? ? 'CLONING ARTIFACT' 142 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2P6Y _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.36 _exptl_crystal.density_percent_sol 63.41 _exptl_crystal.description 'THE STRUCTURE FACTOR FILE CONTAINS FRIEDEL PAIRS' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '10 mM MgSO4, 50 mM Cacodylic acid, 200 mM (NH4)2SO4, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2007-03-07 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97900 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97900 # _reflns.entry_id 2P6Y _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.63 _reflns.number_obs 51743 _reflns.number_all ? _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.064 _reflns.pdbx_netI_over_sigmaI 56 _reflns.B_iso_Wilson_estimate 16.0 _reflns.pdbx_redundancy 21.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.63 _reflns_shell.d_res_low 1.69 _reflns_shell.percent_possible_all 92.1 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.5 _reflns_shell.meanI_over_sigI_obs 8.1 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2P6Y _refine.ls_number_reflns_obs 48111 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.0 _refine.pdbx_data_cutoff_high_absF 96439.94 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.97 _refine.ls_d_res_high 1.63 _refine.ls_percent_reflns_obs 92.9 _refine.ls_R_factor_obs 0.207 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.207 _refine.ls_R_factor_R_free 0.223 _refine.ls_R_factor_R_free_error 0.005 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 2391 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 19.2 _refine.aniso_B[1][1] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[3][3] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.380998 _refine.solvent_model_param_bsol 45.4679 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'THE FRIEDEL PAIRS WERE USED FOR PHASING' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2P6Y _refine_analyze.Luzzati_coordinate_error_obs 0.18 _refine_analyze.Luzzati_sigma_a_obs 0.04 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.20 _refine_analyze.Luzzati_sigma_a_free 0.01 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1017 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 146 _refine_hist.number_atoms_total 1164 _refine_hist.d_res_high 1.63 _refine_hist.d_res_low 19.97 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.004 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.1 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.63 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.10 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 1.71 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.15 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.04 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.63 _refine_ls_shell.d_res_low 1.73 _refine_ls_shell.number_reflns_R_work 6593 _refine_ls_shell.R_factor_R_work 0.21 _refine_ls_shell.percent_reflns_obs 80.0 _refine_ls_shell.R_factor_R_free 0.218 _refine_ls_shell.R_factor_R_free_error 0.012 _refine_ls_shell.percent_reflns_R_free 4.8 _refine_ls_shell.number_reflns_R_free 332 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 ion.param ion.top 'X-RAY DIFFRACTION' # _struct.entry_id 2P6Y _struct.title ;X-ray structure of the protein Q9KM02_VIBCH from Vibrio cholerae at the resolution 1.63 A. Northeast Structural Genomics Consortium target VcR80. ; _struct.pdbx_descriptor 'Hypothetical protein VCA0587' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2P6Y _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;NESG, Q9KM02_VIBCH, VcR80, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 26 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 26 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 75 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 75 A ZN 201 1_555 ? ? ? ? ? ? ? 2.156 ? metalc2 metalc ? ? A HIS 77 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 77 A ZN 201 1_555 ? ? ? ? ? ? ? 2.117 ? metalc3 metalc ? ? A HIS 91 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 91 A ZN 201 1_555 ? ? ? ? ? ? ? 2.335 ? covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A ILE 2 N ? ? A MSE 1 A ILE 2 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A GLY 12 C ? ? ? 1_555 A MSE 13 N ? ? A GLY 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale ? ? A MSE 13 C ? ? ? 1_555 A ASP 14 N ? ? A MSE 13 A ASP 14 1_555 ? ? ? ? ? ? ? 1.327 ? covale4 covale ? ? A LEU 104 C ? ? ? 1_555 A MSE 105 N ? ? A LEU 104 A MSE 105 1_555 ? ? ? ? ? ? ? 1.327 ? covale5 covale ? ? A MSE 105 C ? ? ? 1_555 A ILE 106 N ? ? A MSE 105 A ILE 106 1_555 ? ? ? ? ? ? ? 1.325 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 53 ? VAL A 56 ? THR A 53 VAL A 56 A 2 GLY A 31 ? ARG A 46 ? GLY A 31 ARG A 46 A 3 PHE A 60 ? LEU A 69 ? PHE A 60 LEU A 69 A 4 CYS A 74 ? ALA A 81 ? CYS A 74 ALA A 81 A 5 VAL A 87 ? LEU A 92 ? VAL A 87 LEU A 92 A 6 GLY A 31 ? ARG A 46 ? GLY A 31 ARG A 46 A 7 LEU A 97 ? HIS A 108 ? LEU A 97 HIS A 108 A 8 HIS A 3 ? LEU A 9 ? HIS A 3 LEU A 9 B 1 HIS A 112 ? PHE A 118 ? HIS A 112 PHE A 118 B 2 SER A 125 ? ALA A 131 ? SER A 125 ALA A 131 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 56 ? O VAL A 56 N LEU A 43 ? N LEU A 43 A 2 3 N GLY A 38 ? N GLY A 38 O ILE A 62 ? O ILE A 62 A 3 4 N SER A 66 ? N SER A 66 O HIS A 77 ? O HIS A 77 A 4 5 N LEU A 76 ? N LEU A 76 O LEU A 92 ? O LEU A 92 A 5 6 O HIS A 91 ? O HIS A 91 N ARG A 46 ? N ARG A 46 A 6 7 N VAL A 37 ? N VAL A 37 O GLU A 103 ? O GLU A 103 A 7 8 O HIS A 108 ? O HIS A 108 N HIS A 3 ? N HIS A 3 B 1 2 N GLU A 117 ? N GLU A 117 O GLU A 126 ? O GLU A 126 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 61 ? GLU A 61 . ? 9_555 ? 2 AC1 4 HIS A 75 ? HIS A 75 . ? 1_555 ? 3 AC1 4 HIS A 77 ? HIS A 77 . ? 1_555 ? 4 AC1 4 HIS A 91 ? HIS A 91 . ? 1_555 ? # _database_PDB_matrix.entry_id 2P6Y _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2P6Y _atom_sites.fract_transf_matrix[1][1] 0.005783 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.005783 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005783 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 MSE 13 13 13 MSE MSE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 THR 100 100 ? ? ? A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 MSE 105 105 105 MSE MSE A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 ALA 133 133 ? ? ? A . n A 1 134 LEU 134 134 ? ? ? A . n A 1 135 GLU 135 135 ? ? ? A . n A 1 136 HIS 136 136 ? ? ? A . n A 1 137 HIS 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n A 1 139 HIS 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n A 1 141 HIS 141 141 ? ? ? A . n A 1 142 HIS 142 142 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN2 A . C 3 HOH 1 202 1 HOH TIP A . C 3 HOH 2 203 2 HOH TIP A . C 3 HOH 3 204 3 HOH TIP A . C 3 HOH 4 205 4 HOH TIP A . C 3 HOH 5 206 5 HOH TIP A . C 3 HOH 6 207 6 HOH TIP A . C 3 HOH 7 208 7 HOH TIP A . C 3 HOH 8 209 8 HOH HOH A . C 3 HOH 9 210 9 HOH HOH A . C 3 HOH 10 211 10 HOH TIP A . C 3 HOH 11 212 11 HOH TIP A . C 3 HOH 12 213 12 HOH TIP A . C 3 HOH 13 214 13 HOH TIP A . C 3 HOH 14 215 14 HOH TIP A . C 3 HOH 15 216 15 HOH TIP A . C 3 HOH 16 217 16 HOH TIP A . C 3 HOH 17 218 17 HOH TIP A . C 3 HOH 18 219 18 HOH TIP A . C 3 HOH 19 220 19 HOH TIP A . C 3 HOH 20 221 20 HOH TIP A . C 3 HOH 21 222 21 HOH TIP A . C 3 HOH 22 223 22 HOH TIP A . C 3 HOH 23 224 23 HOH TIP A . C 3 HOH 24 225 24 HOH TIP A . C 3 HOH 25 226 25 HOH TIP A . C 3 HOH 26 227 26 HOH TIP A . C 3 HOH 27 228 27 HOH TIP A . C 3 HOH 28 229 28 HOH TIP A . C 3 HOH 29 230 29 HOH TIP A . C 3 HOH 30 231 30 HOH TIP A . C 3 HOH 31 232 31 HOH TIP A . C 3 HOH 32 233 32 HOH TIP A . C 3 HOH 33 234 33 HOH TIP A . C 3 HOH 34 235 34 HOH TIP A . C 3 HOH 35 236 35 HOH TIP A . C 3 HOH 36 237 36 HOH TIP A . C 3 HOH 37 238 37 HOH TIP A . C 3 HOH 38 239 38 HOH TIP A . C 3 HOH 39 240 39 HOH TIP A . C 3 HOH 40 241 40 HOH TIP A . C 3 HOH 41 242 41 HOH TIP A . C 3 HOH 42 243 42 HOH TIP A . C 3 HOH 43 244 43 HOH TIP A . C 3 HOH 44 245 44 HOH TIP A . C 3 HOH 45 246 45 HOH TIP A . C 3 HOH 46 247 46 HOH TIP A . C 3 HOH 47 248 47 HOH TIP A . C 3 HOH 48 249 48 HOH TIP A . C 3 HOH 49 250 49 HOH TIP A . C 3 HOH 50 251 50 HOH TIP A . C 3 HOH 51 252 51 HOH TIP A . C 3 HOH 52 253 52 HOH TIP A . C 3 HOH 53 254 53 HOH TIP A . C 3 HOH 54 255 54 HOH TIP A . C 3 HOH 55 256 55 HOH TIP A . C 3 HOH 56 257 56 HOH TIP A . C 3 HOH 57 258 57 HOH TIP A . C 3 HOH 58 259 58 HOH TIP A . C 3 HOH 59 260 59 HOH TIP A . C 3 HOH 60 261 60 HOH TIP A . C 3 HOH 61 262 61 HOH TIP A . C 3 HOH 62 263 62 HOH TIP A . C 3 HOH 63 264 63 HOH TIP A . C 3 HOH 64 265 64 HOH TIP A . C 3 HOH 65 266 65 HOH TIP A . C 3 HOH 66 267 66 HOH TIP A . C 3 HOH 67 268 67 HOH TIP A . C 3 HOH 68 269 68 HOH TIP A . C 3 HOH 69 270 69 HOH TIP A . C 3 HOH 70 271 70 HOH TIP A . C 3 HOH 71 272 71 HOH TIP A . C 3 HOH 72 273 72 HOH TIP A . C 3 HOH 73 274 73 HOH TIP A . C 3 HOH 74 275 74 HOH TIP A . C 3 HOH 75 276 75 HOH TIP A . C 3 HOH 76 277 76 HOH TIP A . C 3 HOH 77 278 77 HOH TIP A . C 3 HOH 78 279 78 HOH TIP A . C 3 HOH 79 280 79 HOH TIP A . C 3 HOH 80 281 80 HOH TIP A . C 3 HOH 81 282 81 HOH TIP A . C 3 HOH 82 283 82 HOH TIP A . C 3 HOH 83 284 83 HOH TIP A . C 3 HOH 84 285 84 HOH TIP A . C 3 HOH 85 286 85 HOH TIP A . C 3 HOH 86 287 86 HOH TIP A . C 3 HOH 87 288 87 HOH TIP A . C 3 HOH 88 289 88 HOH TIP A . C 3 HOH 89 290 89 HOH TIP A . C 3 HOH 90 291 90 HOH TIP A . C 3 HOH 91 292 91 HOH TIP A . C 3 HOH 92 293 92 HOH TIP A . C 3 HOH 93 294 93 HOH TIP A . C 3 HOH 94 295 94 HOH TIP A . C 3 HOH 95 296 95 HOH TIP A . C 3 HOH 96 297 96 HOH TIP A . C 3 HOH 97 298 97 HOH TIP A . C 3 HOH 98 299 98 HOH TIP A . C 3 HOH 99 300 99 HOH TIP A . C 3 HOH 100 301 100 HOH TIP A . C 3 HOH 101 302 101 HOH TIP A . C 3 HOH 102 303 102 HOH TIP A . C 3 HOH 103 304 103 HOH TIP A . C 3 HOH 104 305 104 HOH TIP A . C 3 HOH 105 306 105 HOH TIP A . C 3 HOH 106 307 106 HOH TIP A . C 3 HOH 107 308 107 HOH TIP A . C 3 HOH 108 309 108 HOH TIP A . C 3 HOH 109 310 109 HOH TIP A . C 3 HOH 110 311 110 HOH TIP A . C 3 HOH 111 312 111 HOH TIP A . C 3 HOH 112 313 112 HOH TIP A . C 3 HOH 113 314 113 HOH TIP A . C 3 HOH 114 315 114 HOH TIP A . C 3 HOH 115 316 115 HOH TIP A . C 3 HOH 116 317 116 HOH TIP A . C 3 HOH 117 318 117 HOH TIP A . C 3 HOH 118 319 118 HOH TIP A . C 3 HOH 119 320 119 HOH TIP A . C 3 HOH 120 321 120 HOH TIP A . C 3 HOH 121 322 121 HOH TIP A . C 3 HOH 122 323 122 HOH TIP A . C 3 HOH 123 324 123 HOH TIP A . C 3 HOH 124 325 124 HOH TIP A . C 3 HOH 125 326 125 HOH TIP A . C 3 HOH 126 327 126 HOH TIP A . C 3 HOH 127 328 127 HOH TIP A . C 3 HOH 128 329 128 HOH TIP A . C 3 HOH 129 330 129 HOH TIP A . C 3 HOH 130 331 130 HOH TIP A . C 3 HOH 131 332 131 HOH TIP A . C 3 HOH 132 333 132 HOH TIP A . C 3 HOH 133 334 133 HOH TIP A . C 3 HOH 134 335 134 HOH TIP A . C 3 HOH 135 336 135 HOH TIP A . C 3 HOH 136 337 136 HOH TIP A . C 3 HOH 137 338 137 HOH TIP A . C 3 HOH 138 339 138 HOH TIP A . C 3 HOH 139 340 139 HOH TIP A . C 3 HOH 140 341 140 HOH TIP A . C 3 HOH 141 342 141 HOH TIP A . C 3 HOH 142 343 142 HOH TIP A . C 3 HOH 143 344 143 HOH TIP A . C 3 HOH 144 345 144 HOH TIP A . C 3 HOH 145 346 145 HOH TIP A . C 3 HOH 146 347 146 HOH TIP A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 13 A MSE 13 ? MET SELENOMETHIONINE 3 A MSE 105 A MSE 105 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA trimeric 3 2 software_defined_assembly PQS 24-meric 24 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2,3 A,B,C 2 1,4,5,6,2,7,8,9,3,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24 A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7610 ? 1 MORE -161 ? 1 'SSA (A^2)' 15080 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 4 'crystal symmetry operation' 2_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 6 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 7 'crystal symmetry operation' 6_566 z,-x+1,-y+1 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 8 'crystal symmetry operation' 7_665 -z+1,-x+1,y 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 8_656 -z+1,x,-y+1 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 10 'crystal symmetry operation' 10_656 -y+1,z,-x+1 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 11 'crystal symmetry operation' 11_566 y,-z+1,-x+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 12 'crystal symmetry operation' 12_665 -y+1,-z+1,x 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 13 'crystal symmetry operation' 13_556 y,x,-z+1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 14 'crystal symmetry operation' 14_666 -y+1,-x+1,-z+1 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 15 'crystal symmetry operation' 15_565 y,-x+1,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 16 'crystal symmetry operation' 16_655 -y+1,x,z 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 17 'crystal symmetry operation' 17_556 x,z,-y+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 18 'crystal symmetry operation' 18_655 -x+1,z,y -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 19 'crystal symmetry operation' 19_666 -x+1,-z+1,-y+1 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 20 'crystal symmetry operation' 20_565 x,-z+1,y 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 21 'crystal symmetry operation' 21_556 z,y,-x+1 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 22 'crystal symmetry operation' 22_565 z,-y+1,x 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 23 'crystal symmetry operation' 23_655 -z+1,y,x 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 24 'crystal symmetry operation' 24_666 -z+1,-y+1,-x+1 0.0000000000 0.0000000000 -1.0000000000 172.9240000000 0.0000000000 -1.0000000000 0.0000000000 172.9240000000 -1.0000000000 0.0000000000 0.0000000000 172.9240000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 75 ? A HIS 75 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 102.2 ? 2 NE2 ? A HIS 75 ? A HIS 75 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 103.4 ? 3 NE2 ? A HIS 77 ? A HIS 77 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 91 ? A HIS 91 ? 1_555 109.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-05 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 ADSC 'data collection' Quantum ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SnB phasing . ? 5 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ; BIOMOLECULE: 1 THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN(S). SEE REMARK 350 FOR INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S). THE TRIMERIC ASSEMBLY OF THE BIOLOGICAL UNIT, SHOWN IN REMARK 350, HAS BEEN EXPERIMENTALLY DETERMINED BY THE AUTHORS. ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 209 ? ? O A HOH 274 ? ? 1.63 2 1 O A HOH 210 ? ? O A HOH 257 ? ? 2.12 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 262 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 262 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 28_555 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 36 ? ? -155.70 54.25 2 1 VAL A 51 ? ? -133.90 -47.26 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 100 ? A THR 100 2 1 Y 1 A ALA 133 ? A ALA 133 3 1 Y 1 A LEU 134 ? A LEU 134 4 1 Y 1 A GLU 135 ? A GLU 135 5 1 Y 1 A HIS 136 ? A HIS 136 6 1 Y 1 A HIS 137 ? A HIS 137 7 1 Y 1 A HIS 138 ? A HIS 138 8 1 Y 1 A HIS 139 ? A HIS 139 9 1 Y 1 A HIS 140 ? A HIS 140 10 1 Y 1 A HIS 141 ? A HIS 141 11 1 Y 1 A HIS 142 ? A HIS 142 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH #