data_2PE0 # _entry.id 2PE0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2PE0 RCSB RCSB042271 WWPDB D_1000042271 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1Z5M ;Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl)amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2-dimethylpropanediamide Complexed with Human PDK1 ; unspecified PDB 1OKY 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH STAUROSPORINE' unspecified PDB 1OKZ 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH UCN-01' unspecified PDB 1UU3 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH LY333531' unspecified PDB 1UU7 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH BIM-2' unspecified PDB 1UU8 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH BIM-1' unspecified PDB 1UU9 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH BIM-3' unspecified PDB 1UVR 'STRUCTURE OF HUMAN PDK1 KINASE DOMAIN IN COMPLEX WITH BIM-8' unspecified PDB 1H1W 'HIGH RESOLUTION CRYSTAL STRUCTURE OF THE HUMAN PDK1 CATALYTIC DOMAIN' unspecified PDB 2PE1 ;CRYSTAL STRUCTURE OF HUMAN PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 (PDK1) {2-OXO-3-[1-(1H-PYRROL-2-YL)-ETH-(Z)-YLIDENE]-2,3-DIHYDRO-1H-INDOL-5-YL}-UREA {BX-517} COMPLEX ; unspecified PDB 2PE2 ;CRYSTAL STRUCTURE OF HUMAN PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 (PDK1) 3-{5-[2-Oxo-5-ureido-1,2-dihydro-indol-(3Z)-ylidenemethyl]-1H-pyrrol-3-yl}-N-(2-piperidin-1-yl-ethyl)-benzamide COMPLEX ; unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PE0 _pdbx_database_status.recvd_initial_deposition_date 2007-04-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Whitlow, M.' 1 'Adler, M.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Indolinone based phosphoinositide-dependent kinase-1 (PDK1) inhibitors. Part 1: Design, synthesis and biological activity.' Bioorg.Med.Chem.Lett. 17 3814 3818 2007 BMCLE8 UK 0960-894X 1127 ? 17531483 10.1016/j.bmcl.2007.04.071 1 'Indolinone based Phhosphoinositide-Dependent Kinase-1 (PDK1) inhibitors- Part 2: Optimization of BX-517' 'To be Published' ? ? ? 2007 ? ? ? 0353 ? ? ? 2 'Novel Small Molecule Inhibitors of 3-Phosphoinositide-Dependent Kinase-1.' J.Biol.Chem. 280 19867 19874 2005 JBCHA3 US 0021-9258 0071 ? ? ? 3 'High Resolution Crystal Structure of the Human Pdk1 Catalytic Domain Defines the Regulatory Phosphopeptide Docking Site.' 'Embo J.' 21 4219 4228 2002 EMJODG UK 0261-4189 0897 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Islam, I.' 1 primary 'Bryant, J.' 2 primary 'Chou, Y.L.' 3 primary 'Kochanny, M.J.' 4 primary 'Lee, W.' 5 primary 'Phillips, G.B.' 6 primary 'Yu, H.' 7 primary 'Adler, M.' 8 primary 'Whitlow, M.' 9 primary 'Ho, E.' 10 primary 'Lentz, D.' 11 primary 'Polokoff, M.A.' 12 primary 'Subramanyam, B.' 13 primary 'Wu, J.M.' 14 primary 'Zhu, D.' 15 primary 'Feldman, R.I.' 16 primary 'Arnaiz, D.O.' 17 1 'Islam, I.' 18 1 'Brown, G.' 19 1 'Bryant, J.' 20 1 'Hrvatin, P.' 21 1 'Kochanny, M.J.' 22 1 'Phillips, G.B.' 23 1 'Yuan, S.' 24 1 'Adler, M.' 25 1 'Whitlow, M.' 26 1 'Lentz, D.' 27 1 'Polokoff, M.A.' 28 1 'Wu, J.' 29 1 'Shen, J.' 30 1 'Walters, J.' 31 1 'Ho, E.' 32 1 'Subramanyam, B.' 33 1 'Zhu, D.' 34 1 'Feldman, R.I.' 35 1 'Arnaiz, D.O.' 36 2 'Feldman, R.I.' 37 2 'Wu, J.M.' 38 2 'Polokoff, M.A.' 39 2 'Kochanny, M.J.' 40 2 'Dinter, H.' 41 2 'Zhu, D.' 42 2 'Biroc, S.L.' 43 2 'Alicke, B.' 44 2 'Bryant, J.' 45 2 'Yuan, S.' 46 2 'Buckman, B.O.' 47 2 'Lentz, D.' 48 2 'Ferrer, M.' 49 2 'Whitlow, M.' 50 2 'Adler, M.' 51 2 'Finster, S.' 52 2 'Chang, Z.' 53 2 'Arnaiz, D.O.' 54 3 'Biondi, R.M.' 55 3 'Komander, D.' 56 3 'Thomas, C.C.' 57 3 'Lizcano, J.M.' 58 3 'Deak, M.' 59 3 'Alessi, D.R.' 60 3 'Van Aalten, D.M.F.' 61 # _cell.entry_id 2PE0 _cell.length_a 123.951 _cell.length_b 123.951 _cell.length_c 47.217 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2PE0 _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-phosphoinositide-dependent protein kinase 1' 33130.117 1 2.7.11.1 ? 'KINASE DOMAIN' ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn '5-HYDROXY-3-[(1R)-1-(1H-PYRROL-2-YL)ETHYL]-2H-INDOL-2-ONE' 240.257 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 5 water nat water 18.015 49 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hPDK1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDE KLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPE SKQARAN(SEP)FVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKA RDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _entity_poly.pdbx_seq_one_letter_code_can ;PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDE KLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPE SKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLV EKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 ARG n 1 3 LYS n 1 4 LYS n 1 5 ARG n 1 6 PRO n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 LYS n 1 11 PHE n 1 12 GLY n 1 13 LYS n 1 14 ILE n 1 15 LEU n 1 16 GLY n 1 17 GLU n 1 18 GLY n 1 19 SER n 1 20 PHE n 1 21 SER n 1 22 THR n 1 23 VAL n 1 24 VAL n 1 25 LEU n 1 26 ALA n 1 27 ARG n 1 28 GLU n 1 29 LEU n 1 30 ALA n 1 31 THR n 1 32 SER n 1 33 ARG n 1 34 GLU n 1 35 TYR n 1 36 ALA n 1 37 ILE n 1 38 LYS n 1 39 ILE n 1 40 LEU n 1 41 GLU n 1 42 LYS n 1 43 ARG n 1 44 HIS n 1 45 ILE n 1 46 ILE n 1 47 LYS n 1 48 GLU n 1 49 ASN n 1 50 LYS n 1 51 VAL n 1 52 PRO n 1 53 TYR n 1 54 VAL n 1 55 THR n 1 56 ARG n 1 57 GLU n 1 58 ARG n 1 59 ASP n 1 60 VAL n 1 61 MET n 1 62 SER n 1 63 ARG n 1 64 LEU n 1 65 ASP n 1 66 HIS n 1 67 PRO n 1 68 PHE n 1 69 PHE n 1 70 VAL n 1 71 LYS n 1 72 LEU n 1 73 TYR n 1 74 PHE n 1 75 THR n 1 76 PHE n 1 77 GLN n 1 78 ASP n 1 79 ASP n 1 80 GLU n 1 81 LYS n 1 82 LEU n 1 83 TYR n 1 84 PHE n 1 85 GLY n 1 86 LEU n 1 87 SER n 1 88 TYR n 1 89 ALA n 1 90 LYS n 1 91 ASN n 1 92 GLY n 1 93 GLU n 1 94 LEU n 1 95 LEU n 1 96 LYS n 1 97 TYR n 1 98 ILE n 1 99 ARG n 1 100 LYS n 1 101 ILE n 1 102 GLY n 1 103 SER n 1 104 PHE n 1 105 ASP n 1 106 GLU n 1 107 THR n 1 108 CYS n 1 109 THR n 1 110 ARG n 1 111 PHE n 1 112 TYR n 1 113 THR n 1 114 ALA n 1 115 GLU n 1 116 ILE n 1 117 VAL n 1 118 SER n 1 119 ALA n 1 120 LEU n 1 121 GLU n 1 122 TYR n 1 123 LEU n 1 124 HIS n 1 125 GLY n 1 126 LYS n 1 127 GLY n 1 128 ILE n 1 129 ILE n 1 130 HIS n 1 131 ARG n 1 132 ASP n 1 133 LEU n 1 134 LYS n 1 135 PRO n 1 136 GLU n 1 137 ASN n 1 138 ILE n 1 139 LEU n 1 140 LEU n 1 141 ASN n 1 142 GLU n 1 143 ASP n 1 144 MET n 1 145 HIS n 1 146 ILE n 1 147 GLN n 1 148 ILE n 1 149 THR n 1 150 ASP n 1 151 PHE n 1 152 GLY n 1 153 THR n 1 154 ALA n 1 155 LYS n 1 156 VAL n 1 157 LEU n 1 158 SER n 1 159 PRO n 1 160 GLU n 1 161 SER n 1 162 LYS n 1 163 GLN n 1 164 ALA n 1 165 ARG n 1 166 ALA n 1 167 ASN n 1 168 SEP n 1 169 PHE n 1 170 VAL n 1 171 GLY n 1 172 THR n 1 173 ALA n 1 174 GLN n 1 175 TYR n 1 176 VAL n 1 177 SER n 1 178 PRO n 1 179 GLU n 1 180 LEU n 1 181 LEU n 1 182 THR n 1 183 GLU n 1 184 LYS n 1 185 SER n 1 186 ALA n 1 187 CYS n 1 188 LYS n 1 189 SER n 1 190 SER n 1 191 ASP n 1 192 LEU n 1 193 TRP n 1 194 ALA n 1 195 LEU n 1 196 GLY n 1 197 CYS n 1 198 ILE n 1 199 ILE n 1 200 TYR n 1 201 GLN n 1 202 LEU n 1 203 VAL n 1 204 ALA n 1 205 GLY n 1 206 LEU n 1 207 PRO n 1 208 PRO n 1 209 PHE n 1 210 ARG n 1 211 ALA n 1 212 GLY n 1 213 ASN n 1 214 GLU n 1 215 TYR n 1 216 LEU n 1 217 ILE n 1 218 PHE n 1 219 GLN n 1 220 LYS n 1 221 ILE n 1 222 ILE n 1 223 LYS n 1 224 LEU n 1 225 GLU n 1 226 TYR n 1 227 ASP n 1 228 PHE n 1 229 PRO n 1 230 GLU n 1 231 LYS n 1 232 PHE n 1 233 PHE n 1 234 PRO n 1 235 LYS n 1 236 ALA n 1 237 ARG n 1 238 ASP n 1 239 LEU n 1 240 VAL n 1 241 GLU n 1 242 LYS n 1 243 LEU n 1 244 LEU n 1 245 VAL n 1 246 LEU n 1 247 ASP n 1 248 ALA n 1 249 THR n 1 250 LYS n 1 251 ARG n 1 252 LEU n 1 253 GLY n 1 254 CYS n 1 255 GLU n 1 256 GLU n 1 257 MET n 1 258 GLU n 1 259 GLY n 1 260 TYR n 1 261 GLY n 1 262 PRO n 1 263 LEU n 1 264 LYS n 1 265 ALA n 1 266 HIS n 1 267 PRO n 1 268 PHE n 1 269 PHE n 1 270 GLU n 1 271 SER n 1 272 VAL n 1 273 THR n 1 274 TRP n 1 275 GLU n 1 276 ASN n 1 277 LEU n 1 278 HIS n 1 279 GLN n 1 280 GLN n 1 281 THR n 1 282 PRO n 1 283 PRO n 1 284 LYS n 1 285 LEU n 1 286 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'PDPK1, PDK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'unidentified baculovirus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10469 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'SF-21 CELLS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PBLUEBAC4.5 _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PDK1-CAT/PBB4.5 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PDPK1_HUMAN _struct_ref.pdbx_db_accession O15530 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDE KLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPE SKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLV EKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT ; _struct_ref.pdbx_align_begin 74 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PE0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 286 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15530 _struct_ref_seq.db_align_beg 74 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 359 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 74 _struct_ref_seq.pdbx_auth_seq_align_end 359 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2PE0 _struct_ref_seq_dif.mon_id SEP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 168 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O15530 _struct_ref_seq_dif.db_mon_id SER _struct_ref_seq_dif.pdbx_seq_db_seq_num 241 _struct_ref_seq_dif.details 'MODIFIED RESIDUE' _struct_ref_seq_dif.pdbx_auth_seq_num 241 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 39Z non-polymer . '5-HYDROXY-3-[(1R)-1-(1H-PYRROL-2-YL)ETHYL]-2H-INDOL-2-ONE' ? 'C14 H12 N2 O2' 240.257 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2PE0 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.20 _exptl_crystal.density_percent_sol 62.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pdbx_details 'AMMONIUM SULFATE, TRIS, EDTA, VAPOR DIFFUSION, HANGING DROP, temperature 298K, pH 7.50' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 96.2 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2003-10-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.150 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_wavelength 1.150 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2PE0 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.000 _reflns.d_resolution_high 2.350 _reflns.number_obs 17172 _reflns.number_all ? _reflns.percent_possible_obs 97.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.10440 _reflns.pdbx_netI_over_sigmaI 7.4400 _reflns.B_iso_Wilson_estimate 23.40 _reflns.pdbx_redundancy 2.620 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.35 _reflns_shell.d_res_low 2.49 _reflns_shell.percent_possible_all 99.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.39740 _reflns_shell.meanI_over_sigI_obs 1.610 _reflns_shell.pdbx_redundancy 2.70 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2PE0 _refine.ls_number_reflns_obs 14788 _refine.ls_number_reflns_all 17151 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.000 _refine.pdbx_data_cutoff_high_absF 170420.850 _refine.pdbx_data_cutoff_low_absF 0.0000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.71 _refine.ls_d_res_high 2.35 _refine.ls_percent_reflns_obs 83.9 _refine.ls_R_factor_obs 0.202 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.200 _refine.ls_R_factor_R_free 0.240 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.100 _refine.ls_number_reflns_R_free 613 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 25.90 _refine.aniso_B[1][1] -0.64000 _refine.aniso_B[2][2] -0.64000 _refine.aniso_B[3][3] 1.28000 _refine.aniso_B[1][2] 8.68000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.35 _refine.solvent_model_param_bsol 38.97 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'DIFFERENCE FOURIER PLUS REFINEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2PE0 _refine_analyze.Luzzati_coordinate_error_obs 0.26 _refine_analyze.Luzzati_sigma_a_obs 0.26 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.32 _refine_analyze.Luzzati_sigma_a_free 0.30 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2255 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.number_atoms_solvent 49 _refine_hist.number_atoms_total 2350 _refine_hist.d_res_high 2.35 _refine_hist.d_res_low 19.71 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 0.90 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 21.40 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.62 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.860 2.000 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.900 2.500 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.080 2.500 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.480 3.500 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.35 _refine_ls_shell.d_res_low 2.50 _refine_ls_shell.number_reflns_R_work 2018 _refine_ls_shell.R_factor_R_work 0.2440 _refine_ls_shell.percent_reflns_obs 71.60 _refine_ls_shell.R_factor_R_free 0.2724 _refine_ls_shell.R_factor_R_free_error 0.031 _refine_ls_shell.percent_reflns_R_free 3.6 _refine_ls_shell.number_reflns_R_free 76 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _pdbx_refine.entry_id 2PE0 _pdbx_refine.R_factor_all_no_cutoff 0.221 _pdbx_refine.R_factor_obs_no_cutoff 0.219 _pdbx_refine.free_R_factor_no_cutoff 0.252 _pdbx_refine.free_R_error_no_cutoff 0.010 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 4.0 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 688 _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PAR PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PAR WATER.TOP 'X-RAY DIFFRACTION' 3 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' 4 SPH.PAR SPH.TOP 'X-RAY DIFFRACTION' 5 394.PAR 394.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 2PE0 _struct.title ;CRYSTAL STRUCTURE OF HUMAN PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 (PDK1) 5-Hydroxy-3-[1-(1H-pyrrol-2-yl)-eth-(Z)-ylidene]-1,3-dihydro-indol-2-one COMPLEX ; _struct.pdbx_descriptor '3-phosphoinositide-dependent protein kinase 1 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PE0 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'PROTEIN INHIBITOR COMPLEX, SERINE KINASE, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 4 ? H N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 5 ? GLU A 7 ? ARG A 78 GLU A 80 5 ? 3 HELX_P HELX_P2 2 LYS A 42 ? GLU A 48 ? LYS A 115 GLU A 121 1 ? 7 HELX_P HELX_P3 3 LYS A 50 ? LEU A 64 ? LYS A 123 LEU A 137 1 ? 15 HELX_P HELX_P4 4 GLU A 93 ? GLY A 102 ? GLU A 166 GLY A 175 1 ? 10 HELX_P HELX_P5 5 ASP A 105 ? LYS A 126 ? ASP A 178 LYS A 199 1 ? 22 HELX_P HELX_P6 6 THR A 172 ? VAL A 176 ? THR A 245 VAL A 249 5 ? 5 HELX_P HELX_P7 7 SER A 177 ? GLU A 183 ? SER A 250 GLU A 256 1 ? 7 HELX_P HELX_P8 8 CYS A 187 ? GLY A 205 ? CYS A 260 GLY A 278 1 ? 19 HELX_P HELX_P9 9 ASN A 213 ? LYS A 223 ? ASN A 286 LYS A 296 1 ? 11 HELX_P HELX_P10 10 PHE A 233 ? LYS A 242 ? PHE A 306 LYS A 315 1 ? 10 HELX_P HELX_P11 11 ASP A 247 ? ARG A 251 ? ASP A 320 ARG A 324 5 ? 5 HELX_P HELX_P12 12 CYS A 254 ? GLU A 258 ? CYS A 327 GLU A 331 5 ? 5 HELX_P HELX_P13 13 GLY A 259 ? ALA A 265 ? GLY A 332 ALA A 338 1 ? 7 HELX_P HELX_P14 14 HIS A 266 ? GLU A 270 ? HIS A 339 GLU A 343 5 ? 5 HELX_P HELX_P15 15 ASN A 276 ? GLN A 280 ? ASN A 349 GLN A 353 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SEP _struct_conn.ptnr1_label_seq_id 168 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id PHE _struct_conn.ptnr2_label_seq_id 169 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SEP _struct_conn.ptnr1_auth_seq_id 241 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id PHE _struct_conn.ptnr2_auth_seq_id 242 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.331 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 9 ? GLU A 17 ? PHE A 82 GLU A 90 A 2 SER A 21 ? GLU A 28 ? SER A 94 GLU A 101 A 3 GLU A 34 ? GLU A 41 ? GLU A 107 GLU A 114 A 4 LYS A 81 ? LEU A 86 ? LYS A 154 LEU A 159 A 5 LEU A 72 ? GLN A 77 ? LEU A 145 GLN A 150 B 1 ILE A 128 ? ILE A 129 ? ILE A 201 ILE A 202 B 2 LYS A 155 ? VAL A 156 ? LYS A 228 VAL A 229 C 1 ILE A 138 ? LEU A 140 ? ILE A 211 LEU A 213 C 2 ILE A 146 ? ILE A 148 ? ILE A 219 ILE A 221 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLY A 16 ? N GLY A 89 O VAL A 23 ? O VAL A 96 A 2 3 N VAL A 24 ? N VAL A 97 O ILE A 37 ? O ILE A 110 A 3 4 N ALA A 36 ? N ALA A 109 O LEU A 86 ? O LEU A 159 A 4 5 O GLY A 85 ? O GLY A 158 N PHE A 74 ? N PHE A 147 B 1 2 N ILE A 129 ? N ILE A 202 O LYS A 155 ? O LYS A 228 C 1 2 N LEU A 139 ? N LEU A 212 O GLN A 147 ? O GLN A 220 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 600' AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 601' AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE 39Z A 501' AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL A 602' AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL A 603' AC6 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE GOL A 604' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 LYS A 3 ? LYS A 76 . ? 1_555 ? 2 AC1 6 ARG A 58 ? ARG A 131 . ? 1_555 ? 3 AC1 6 THR A 75 ? THR A 148 . ? 1_555 ? 4 AC1 6 PHE A 76 ? PHE A 149 . ? 1_555 ? 5 AC1 6 GLN A 77 ? GLN A 150 . ? 1_555 ? 6 AC1 6 HOH H . ? HOH A 740 . ? 1_555 ? 7 AC2 3 ARG A 33 ? ARG A 106 . ? 1_555 ? 8 AC2 3 PRO A 67 ? PRO A 140 . ? 6_556 ? 9 AC2 3 HIS A 278 ? HIS A 351 . ? 6_556 ? 10 AC3 8 LEU A 15 ? LEU A 88 . ? 1_555 ? 11 AC3 8 ALA A 36 ? ALA A 109 . ? 1_555 ? 12 AC3 8 SER A 87 ? SER A 160 . ? 1_555 ? 13 AC3 8 TYR A 88 ? TYR A 161 . ? 1_555 ? 14 AC3 8 ALA A 89 ? ALA A 162 . ? 1_555 ? 15 AC3 8 LEU A 139 ? LEU A 212 . ? 1_555 ? 16 AC3 8 THR A 149 ? THR A 222 . ? 1_555 ? 17 AC3 8 HOH H . ? HOH A 796 . ? 1_555 ? 18 AC4 6 GLY A 18 ? GLY A 91 . ? 1_555 ? 19 AC4 6 SER A 19 ? SER A 92 . ? 1_555 ? 20 AC4 6 PHE A 20 ? PHE A 93 . ? 1_555 ? 21 AC4 6 SER A 21 ? SER A 94 . ? 1_555 ? 22 AC4 6 LYS A 38 ? LYS A 111 . ? 1_555 ? 23 AC4 6 ASP A 150 ? ASP A 223 . ? 1_555 ? 24 AC5 4 PHE A 9 ? PHE A 82 . ? 1_555 ? 25 AC5 4 LYS A 10 ? LYS A 83 . ? 1_555 ? 26 AC5 4 PHE A 11 ? PHE A 84 . ? 1_555 ? 27 AC5 4 LYS A 264 ? LYS A 337 . ? 1_556 ? 28 AC6 8 ALA A 30 ? ALA A 103 . ? 6_556 ? 29 AC6 8 THR A 31 ? THR A 104 . ? 6_556 ? 30 AC6 8 HIS A 66 ? HIS A 139 . ? 1_555 ? 31 AC6 8 TRP A 274 ? TRP A 347 . ? 1_555 ? 32 AC6 8 GLU A 275 ? GLU A 348 . ? 1_555 ? 33 AC6 8 ASN A 276 ? ASN A 349 . ? 1_555 ? 34 AC6 8 LEU A 277 ? LEU A 350 . ? 1_555 ? 35 AC6 8 HIS A 278 ? HIS A 351 . ? 1_555 ? # _database_PDB_matrix.entry_id 2PE0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2PE0 _atom_sites.fract_transf_matrix[1][1] 0.008068 _atom_sites.fract_transf_matrix[1][2] 0.004658 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009316 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021179 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 74 74 PRO PRO A . n A 1 2 ARG 2 75 75 ARG ARG A . n A 1 3 LYS 3 76 76 LYS LYS A . n A 1 4 LYS 4 77 77 LYS LYS A . n A 1 5 ARG 5 78 78 ARG ARG A . n A 1 6 PRO 6 79 79 PRO PRO A . n A 1 7 GLU 7 80 80 GLU GLU A . n A 1 8 ASP 8 81 81 ASP ASP A . n A 1 9 PHE 9 82 82 PHE PHE A . n A 1 10 LYS 10 83 83 LYS LYS A . n A 1 11 PHE 11 84 84 PHE PHE A . n A 1 12 GLY 12 85 85 GLY GLY A . n A 1 13 LYS 13 86 86 LYS LYS A . n A 1 14 ILE 14 87 87 ILE ILE A . n A 1 15 LEU 15 88 88 LEU LEU A . n A 1 16 GLY 16 89 89 GLY GLY A . n A 1 17 GLU 17 90 90 GLU GLU A . n A 1 18 GLY 18 91 91 GLY GLY A . n A 1 19 SER 19 92 92 SER SER A . n A 1 20 PHE 20 93 93 PHE PHE A . n A 1 21 SER 21 94 94 SER SER A . n A 1 22 THR 22 95 95 THR THR A . n A 1 23 VAL 23 96 96 VAL VAL A . n A 1 24 VAL 24 97 97 VAL VAL A . n A 1 25 LEU 25 98 98 LEU LEU A . n A 1 26 ALA 26 99 99 ALA ALA A . n A 1 27 ARG 27 100 100 ARG ARG A . n A 1 28 GLU 28 101 101 GLU GLU A . n A 1 29 LEU 29 102 102 LEU LEU A . n A 1 30 ALA 30 103 103 ALA ALA A . n A 1 31 THR 31 104 104 THR THR A . n A 1 32 SER 32 105 105 SER SER A . n A 1 33 ARG 33 106 106 ARG ARG A . n A 1 34 GLU 34 107 107 GLU GLU A . n A 1 35 TYR 35 108 108 TYR TYR A . n A 1 36 ALA 36 109 109 ALA ALA A . n A 1 37 ILE 37 110 110 ILE ILE A . n A 1 38 LYS 38 111 111 LYS LYS A . n A 1 39 ILE 39 112 112 ILE ILE A . n A 1 40 LEU 40 113 113 LEU LEU A . n A 1 41 GLU 41 114 114 GLU GLU A . n A 1 42 LYS 42 115 115 LYS LYS A . n A 1 43 ARG 43 116 116 ARG ARG A . n A 1 44 HIS 44 117 117 HIS HIS A . n A 1 45 ILE 45 118 118 ILE ILE A . n A 1 46 ILE 46 119 119 ILE ILE A . n A 1 47 LYS 47 120 120 LYS LYS A . n A 1 48 GLU 48 121 121 GLU GLU A . n A 1 49 ASN 49 122 122 ASN ASN A . n A 1 50 LYS 50 123 123 LYS LYS A . n A 1 51 VAL 51 124 124 VAL VAL A . n A 1 52 PRO 52 125 125 PRO PRO A . n A 1 53 TYR 53 126 126 TYR TYR A . n A 1 54 VAL 54 127 127 VAL VAL A . n A 1 55 THR 55 128 128 THR THR A . n A 1 56 ARG 56 129 129 ARG ARG A . n A 1 57 GLU 57 130 130 GLU GLU A . n A 1 58 ARG 58 131 131 ARG ARG A . n A 1 59 ASP 59 132 132 ASP ASP A . n A 1 60 VAL 60 133 133 VAL VAL A . n A 1 61 MET 61 134 134 MET MET A . n A 1 62 SER 62 135 135 SER SER A . n A 1 63 ARG 63 136 136 ARG ARG A . n A 1 64 LEU 64 137 137 LEU LEU A . n A 1 65 ASP 65 138 138 ASP ASP A . n A 1 66 HIS 66 139 139 HIS HIS A . n A 1 67 PRO 67 140 140 PRO PRO A . n A 1 68 PHE 68 141 141 PHE PHE A . n A 1 69 PHE 69 142 142 PHE PHE A . n A 1 70 VAL 70 143 143 VAL VAL A . n A 1 71 LYS 71 144 144 LYS LYS A . n A 1 72 LEU 72 145 145 LEU LEU A . n A 1 73 TYR 73 146 146 TYR TYR A . n A 1 74 PHE 74 147 147 PHE PHE A . n A 1 75 THR 75 148 148 THR THR A . n A 1 76 PHE 76 149 149 PHE PHE A . n A 1 77 GLN 77 150 150 GLN GLN A . n A 1 78 ASP 78 151 151 ASP ASP A . n A 1 79 ASP 79 152 152 ASP ASP A . n A 1 80 GLU 80 153 153 GLU GLU A . n A 1 81 LYS 81 154 154 LYS LYS A . n A 1 82 LEU 82 155 155 LEU LEU A . n A 1 83 TYR 83 156 156 TYR TYR A . n A 1 84 PHE 84 157 157 PHE PHE A . n A 1 85 GLY 85 158 158 GLY GLY A . n A 1 86 LEU 86 159 159 LEU LEU A . n A 1 87 SER 87 160 160 SER SER A . n A 1 88 TYR 88 161 161 TYR TYR A . n A 1 89 ALA 89 162 162 ALA ALA A . n A 1 90 LYS 90 163 163 LYS LYS A . n A 1 91 ASN 91 164 164 ASN ASN A . n A 1 92 GLY 92 165 165 GLY GLY A . n A 1 93 GLU 93 166 166 GLU GLU A . n A 1 94 LEU 94 167 167 LEU LEU A . n A 1 95 LEU 95 168 168 LEU LEU A . n A 1 96 LYS 96 169 169 LYS LYS A . n A 1 97 TYR 97 170 170 TYR TYR A . n A 1 98 ILE 98 171 171 ILE ILE A . n A 1 99 ARG 99 172 172 ARG ARG A . n A 1 100 LYS 100 173 173 LYS LYS A . n A 1 101 ILE 101 174 174 ILE ILE A . n A 1 102 GLY 102 175 175 GLY GLY A . n A 1 103 SER 103 176 176 SER SER A . n A 1 104 PHE 104 177 177 PHE PHE A . n A 1 105 ASP 105 178 178 ASP ASP A . n A 1 106 GLU 106 179 179 GLU GLU A . n A 1 107 THR 107 180 180 THR THR A . n A 1 108 CYS 108 181 181 CYS CYS A . n A 1 109 THR 109 182 182 THR THR A . n A 1 110 ARG 110 183 183 ARG ARG A . n A 1 111 PHE 111 184 184 PHE PHE A . n A 1 112 TYR 112 185 185 TYR TYR A . n A 1 113 THR 113 186 186 THR THR A . n A 1 114 ALA 114 187 187 ALA ALA A . n A 1 115 GLU 115 188 188 GLU GLU A . n A 1 116 ILE 116 189 189 ILE ILE A . n A 1 117 VAL 117 190 190 VAL VAL A . n A 1 118 SER 118 191 191 SER SER A . n A 1 119 ALA 119 192 192 ALA ALA A . n A 1 120 LEU 120 193 193 LEU LEU A . n A 1 121 GLU 121 194 194 GLU GLU A . n A 1 122 TYR 122 195 195 TYR TYR A . n A 1 123 LEU 123 196 196 LEU LEU A . n A 1 124 HIS 124 197 197 HIS HIS A . n A 1 125 GLY 125 198 198 GLY GLY A . n A 1 126 LYS 126 199 199 LYS LYS A . n A 1 127 GLY 127 200 200 GLY GLY A . n A 1 128 ILE 128 201 201 ILE ILE A . n A 1 129 ILE 129 202 202 ILE ILE A . n A 1 130 HIS 130 203 203 HIS HIS A . n A 1 131 ARG 131 204 204 ARG ARG A . n A 1 132 ASP 132 205 205 ASP ASP A . n A 1 133 LEU 133 206 206 LEU LEU A . n A 1 134 LYS 134 207 207 LYS LYS A . n A 1 135 PRO 135 208 208 PRO PRO A . n A 1 136 GLU 136 209 209 GLU GLU A . n A 1 137 ASN 137 210 210 ASN ASN A . n A 1 138 ILE 138 211 211 ILE ILE A . n A 1 139 LEU 139 212 212 LEU LEU A . n A 1 140 LEU 140 213 213 LEU LEU A . n A 1 141 ASN 141 214 214 ASN ASN A . n A 1 142 GLU 142 215 215 GLU GLU A . n A 1 143 ASP 143 216 216 ASP ASP A . n A 1 144 MET 144 217 217 MET MET A . n A 1 145 HIS 145 218 218 HIS HIS A . n A 1 146 ILE 146 219 219 ILE ILE A . n A 1 147 GLN 147 220 220 GLN GLN A . n A 1 148 ILE 148 221 221 ILE ILE A . n A 1 149 THR 149 222 222 THR THR A . n A 1 150 ASP 150 223 223 ASP ASP A . n A 1 151 PHE 151 224 224 PHE PHE A . n A 1 152 GLY 152 225 225 GLY GLY A . n A 1 153 THR 153 226 226 THR THR A . n A 1 154 ALA 154 227 227 ALA ALA A . n A 1 155 LYS 155 228 228 LYS LYS A . n A 1 156 VAL 156 229 229 VAL VAL A . n A 1 157 LEU 157 230 230 LEU LEU A . n A 1 158 SER 158 231 ? ? ? A . n A 1 159 PRO 159 232 ? ? ? A . n A 1 160 GLU 160 233 ? ? ? A . n A 1 161 SER 161 234 ? ? ? A . n A 1 162 LYS 162 235 ? ? ? A . n A 1 163 GLN 163 236 ? ? ? A . n A 1 164 ALA 164 237 ? ? ? A . n A 1 165 ARG 165 238 ? ? ? A . n A 1 166 ALA 166 239 ? ? ? A . n A 1 167 ASN 167 240 ? ? ? A . n A 1 168 SEP 168 241 241 SEP SEP A . n A 1 169 PHE 169 242 242 PHE PHE A . n A 1 170 VAL 170 243 243 VAL VAL A . n A 1 171 GLY 171 244 244 GLY GLY A . n A 1 172 THR 172 245 245 THR THR A . n A 1 173 ALA 173 246 246 ALA ALA A . n A 1 174 GLN 174 247 247 GLN GLN A . n A 1 175 TYR 175 248 248 TYR TYR A . n A 1 176 VAL 176 249 249 VAL VAL A . n A 1 177 SER 177 250 250 SER SER A . n A 1 178 PRO 178 251 251 PRO PRO A . n A 1 179 GLU 179 252 252 GLU GLU A . n A 1 180 LEU 180 253 253 LEU LEU A . n A 1 181 LEU 181 254 254 LEU LEU A . n A 1 182 THR 182 255 255 THR THR A . n A 1 183 GLU 183 256 256 GLU GLU A . n A 1 184 LYS 184 257 257 LYS LYS A . n A 1 185 SER 185 258 258 SER SER A . n A 1 186 ALA 186 259 259 ALA ALA A . n A 1 187 CYS 187 260 260 CYS CYS A . n A 1 188 LYS 188 261 261 LYS LYS A . n A 1 189 SER 189 262 262 SER SER A . n A 1 190 SER 190 263 263 SER SER A . n A 1 191 ASP 191 264 264 ASP ASP A . n A 1 192 LEU 192 265 265 LEU LEU A . n A 1 193 TRP 193 266 266 TRP TRP A . n A 1 194 ALA 194 267 267 ALA ALA A . n A 1 195 LEU 195 268 268 LEU LEU A . n A 1 196 GLY 196 269 269 GLY GLY A . n A 1 197 CYS 197 270 270 CYS CYS A . n A 1 198 ILE 198 271 271 ILE ILE A . n A 1 199 ILE 199 272 272 ILE ILE A . n A 1 200 TYR 200 273 273 TYR TYR A . n A 1 201 GLN 201 274 274 GLN GLN A . n A 1 202 LEU 202 275 275 LEU LEU A . n A 1 203 VAL 203 276 276 VAL VAL A . n A 1 204 ALA 204 277 277 ALA ALA A . n A 1 205 GLY 205 278 278 GLY GLY A . n A 1 206 LEU 206 279 279 LEU LEU A . n A 1 207 PRO 207 280 280 PRO PRO A . n A 1 208 PRO 208 281 281 PRO PRO A . n A 1 209 PHE 209 282 282 PHE PHE A . n A 1 210 ARG 210 283 283 ARG ARG A . n A 1 211 ALA 211 284 284 ALA ALA A . n A 1 212 GLY 212 285 285 GLY GLY A . n A 1 213 ASN 213 286 286 ASN ASN A . n A 1 214 GLU 214 287 287 GLU GLU A . n A 1 215 TYR 215 288 288 TYR TYR A . n A 1 216 LEU 216 289 289 LEU LEU A . n A 1 217 ILE 217 290 290 ILE ILE A . n A 1 218 PHE 218 291 291 PHE PHE A . n A 1 219 GLN 219 292 292 GLN GLN A . n A 1 220 LYS 220 293 293 LYS LYS A . n A 1 221 ILE 221 294 294 ILE ILE A . n A 1 222 ILE 222 295 295 ILE ILE A . n A 1 223 LYS 223 296 296 LYS LYS A . n A 1 224 LEU 224 297 297 LEU LEU A . n A 1 225 GLU 225 298 298 GLU GLU A . n A 1 226 TYR 226 299 299 TYR TYR A . n A 1 227 ASP 227 300 300 ASP ASP A . n A 1 228 PHE 228 301 301 PHE PHE A . n A 1 229 PRO 229 302 302 PRO PRO A . n A 1 230 GLU 230 303 303 GLU GLU A . n A 1 231 LYS 231 304 304 LYS LYS A . n A 1 232 PHE 232 305 305 PHE PHE A . n A 1 233 PHE 233 306 306 PHE PHE A . n A 1 234 PRO 234 307 307 PRO PRO A . n A 1 235 LYS 235 308 308 LYS LYS A . n A 1 236 ALA 236 309 309 ALA ALA A . n A 1 237 ARG 237 310 310 ARG ARG A . n A 1 238 ASP 238 311 311 ASP ASP A . n A 1 239 LEU 239 312 312 LEU LEU A . n A 1 240 VAL 240 313 313 VAL VAL A . n A 1 241 GLU 241 314 314 GLU GLU A . n A 1 242 LYS 242 315 315 LYS LYS A . n A 1 243 LEU 243 316 316 LEU LEU A . n A 1 244 LEU 244 317 317 LEU LEU A . n A 1 245 VAL 245 318 318 VAL VAL A . n A 1 246 LEU 246 319 319 LEU LEU A . n A 1 247 ASP 247 320 320 ASP ASP A . n A 1 248 ALA 248 321 321 ALA ALA A . n A 1 249 THR 249 322 322 THR THR A . n A 1 250 LYS 250 323 323 LYS LYS A . n A 1 251 ARG 251 324 324 ARG ARG A . n A 1 252 LEU 252 325 325 LEU LEU A . n A 1 253 GLY 253 326 326 GLY GLY A . n A 1 254 CYS 254 327 327 CYS CYS A . n A 1 255 GLU 255 328 328 GLU GLU A . n A 1 256 GLU 256 329 329 GLU GLU A . n A 1 257 MET 257 330 330 MET MET A . n A 1 258 GLU 258 331 331 GLU GLU A . n A 1 259 GLY 259 332 332 GLY GLY A . n A 1 260 TYR 260 333 333 TYR TYR A . n A 1 261 GLY 261 334 334 GLY GLY A . n A 1 262 PRO 262 335 335 PRO PRO A . n A 1 263 LEU 263 336 336 LEU LEU A . n A 1 264 LYS 264 337 337 LYS LYS A . n A 1 265 ALA 265 338 338 ALA ALA A . n A 1 266 HIS 266 339 339 HIS HIS A . n A 1 267 PRO 267 340 340 PRO PRO A . n A 1 268 PHE 268 341 341 PHE PHE A . n A 1 269 PHE 269 342 342 PHE PHE A . n A 1 270 GLU 270 343 343 GLU GLU A . n A 1 271 SER 271 344 344 SER SER A . n A 1 272 VAL 272 345 345 VAL VAL A . n A 1 273 THR 273 346 346 THR THR A . n A 1 274 TRP 274 347 347 TRP TRP A . n A 1 275 GLU 275 348 348 GLU GLU A . n A 1 276 ASN 276 349 349 ASN ASN A . n A 1 277 LEU 277 350 350 LEU LEU A . n A 1 278 HIS 278 351 351 HIS HIS A . n A 1 279 GLN 279 352 352 GLN GLN A . n A 1 280 GLN 280 353 353 GLN GLN A . n A 1 281 THR 281 354 354 THR THR A . n A 1 282 PRO 282 355 355 PRO PRO A . n A 1 283 PRO 283 356 356 PRO PRO A . n A 1 284 LYS 284 357 357 LYS LYS A . n A 1 285 LEU 285 358 358 LEU LEU A . n A 1 286 THR 286 359 359 THR THR A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 168 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 241 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details PHOSPHOSERINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 797 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id H _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNX refinement . ? 1 XTALVIEW refinement . ? 2 X-GEN 'data reduction' . ? 3 X-GEN 'data scaling' . ? 4 CNX phasing . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 151 ? ? -108.93 -161.02 2 1 SER A 176 ? ? 177.64 146.52 3 1 ARG A 204 ? ? 78.26 -0.88 4 1 ASP A 205 ? ? -146.25 48.22 5 1 ASP A 223 ? ? 78.75 74.81 6 1 CYS A 260 ? ? -174.92 -178.21 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 75 ? CG ? A ARG 2 CG 2 1 Y 1 A ARG 75 ? CD ? A ARG 2 CD 3 1 Y 1 A ARG 75 ? NE ? A ARG 2 NE 4 1 Y 1 A ARG 75 ? CZ ? A ARG 2 CZ 5 1 Y 1 A ARG 75 ? NH1 ? A ARG 2 NH1 6 1 Y 1 A ARG 75 ? NH2 ? A ARG 2 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 231 ? A SER 158 2 1 Y 1 A PRO 232 ? A PRO 159 3 1 Y 1 A GLU 233 ? A GLU 160 4 1 Y 1 A SER 234 ? A SER 161 5 1 Y 1 A LYS 235 ? A LYS 162 6 1 Y 1 A GLN 236 ? A GLN 163 7 1 Y 1 A ALA 237 ? A ALA 164 8 1 Y 1 A ARG 238 ? A ARG 165 9 1 Y 1 A ALA 239 ? A ALA 166 10 1 Y 1 A ASN 240 ? A ASN 167 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '5-HYDROXY-3-[(1R)-1-(1H-PYRROL-2-YL)ETHYL]-2H-INDOL-2-ONE' 39Z 4 GLYCEROL GOL 5 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 600 600 SO4 SO4 A . C 2 SO4 1 601 601 SO4 SO4 A . D 3 39Z 1 501 501 39Z 39Z A . E 4 GOL 1 602 602 GOL GOL A . F 4 GOL 1 603 603 GOL GOL A . G 4 GOL 1 604 604 GOL GOL A . H 5 HOH 1 701 701 HOH HOH A . H 5 HOH 2 702 702 HOH HOH A . H 5 HOH 3 703 703 HOH HOH A . H 5 HOH 4 704 704 HOH HOH A . H 5 HOH 5 705 705 HOH HOH A . H 5 HOH 6 707 707 HOH HOH A . H 5 HOH 7 710 710 HOH HOH A . H 5 HOH 8 711 711 HOH HOH A . H 5 HOH 9 712 712 HOH HOH A . H 5 HOH 10 715 715 HOH HOH A . H 5 HOH 11 719 719 HOH HOH A . H 5 HOH 12 723 723 HOH HOH A . H 5 HOH 13 725 725 HOH HOH A . H 5 HOH 14 727 727 HOH HOH A . H 5 HOH 15 733 733 HOH HOH A . H 5 HOH 16 740 740 HOH HOH A . H 5 HOH 17 746 746 HOH HOH A . H 5 HOH 18 750 750 HOH HOH A . H 5 HOH 19 762 762 HOH HOH A . H 5 HOH 20 763 763 HOH HOH A . H 5 HOH 21 769 769 HOH HOH A . H 5 HOH 22 770 770 HOH HOH A . H 5 HOH 23 771 771 HOH HOH A . H 5 HOH 24 772 772 HOH HOH A . H 5 HOH 25 773 773 HOH HOH A . H 5 HOH 26 774 774 HOH HOH A . H 5 HOH 27 775 775 HOH HOH A . H 5 HOH 28 776 776 HOH HOH A . H 5 HOH 29 778 778 HOH HOH A . H 5 HOH 30 780 780 HOH HOH A . H 5 HOH 31 782 782 HOH HOH A . H 5 HOH 32 783 783 HOH HOH A . H 5 HOH 33 791 791 HOH HOH A . H 5 HOH 34 792 792 HOH HOH A . H 5 HOH 35 793 793 HOH HOH A . H 5 HOH 36 796 796 HOH HOH A . H 5 HOH 37 797 797 HOH HOH A . H 5 HOH 38 800 800 HOH HOH A . H 5 HOH 39 801 801 HOH HOH A . H 5 HOH 40 802 802 HOH HOH A . H 5 HOH 41 803 803 HOH HOH A . H 5 HOH 42 805 805 HOH HOH A . H 5 HOH 43 806 806 HOH HOH A . H 5 HOH 44 807 807 HOH HOH A . H 5 HOH 45 808 808 HOH HOH A . H 5 HOH 46 809 809 HOH HOH A . H 5 HOH 47 810 810 HOH HOH A . H 5 HOH 48 811 811 HOH HOH A . H 5 HOH 49 812 812 HOH HOH A . #