data_2PM1 # _entry.id 2PM1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2PM1 pdb_00002pm1 10.2210/pdb2pm1/pdb RCSB RCSB042524 ? ? WWPDB D_1000042524 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-05-29 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 5 'Structure model' 1 4 2023-08-30 6 'Structure model' 1 5 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Refinement description' 7 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' pdbx_initial_refinement_model 7 6 'Structure model' pdbx_entry_details 8 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'Chirality error at the CB center of THR A 18' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PM1 _pdbx_database_status.recvd_initial_deposition_date 2007-04-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1DFN 'human alpha-defensin 3' unspecified PDB 1ZMH 'human alpha-defensin 2 (mutant)' unspecified PDB 1ZMI 'human alpha-defensin 2 (mutant)' unspecified PDB 1ZMK 'human alpha-defensin 2 (mutant)' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lubkowski, J.' 1 'Pazgier, M.' 2 'Lu, W.' 3 # _citation.id primary _citation.title 'Derivative of human alpha-defensin 1 (HNP1)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lubkowski, J.' 1 ? primary 'Lu, W.' 2 ? primary 'Zou, G.' 3 ? primary 'de Leeuw, E.' 4 ? primary 'Li, C.' 5 ? primary 'Pazgier, M.' 6 ? primary 'Zeng, P.' 7 ? primary 'Lu, W.Y.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Neutrophil defensin 1 (HNP-1) (HP-1) (HP1) (Defensin, alpha 1)' 3280.886 1 ? 'Arg14->Dab, Arg15->Dab, Arg24->Dab' ? ? 2 water nat water 18.015 53 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'ACYCRIPACIAGE(DAB)(DAB)YGTCIYQG(DAB)LWAFCC' _entity_poly.pdbx_seq_one_letter_code_can ACYCRIPACIAGEAAYGTCIYQGALWAFCC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 TYR n 1 4 CYS n 1 5 ARG n 1 6 ILE n 1 7 PRO n 1 8 ALA n 1 9 CYS n 1 10 ILE n 1 11 ALA n 1 12 GLY n 1 13 GLU n 1 14 DAB n 1 15 DAB n 1 16 TYR n 1 17 GLY n 1 18 THR n 1 19 CYS n 1 20 ILE n 1 21 TYR n 1 22 GLN n 1 23 GLY n 1 24 DAB n 1 25 LEU n 1 26 TRP n 1 27 ALA n 1 28 PHE n 1 29 CYS n 1 30 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'DEFA1, DEF1, DEFA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain DEF1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DAB 'L-peptide linking' n '2,4-DIAMINOBUTYRIC ACID' ? 'C4 H10 N2 O2' 118.134 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 DAB 14 14 14 DAB DAB A . n A 1 15 DAB 15 15 15 DAB DAB A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 DAB 24 24 24 DAB DAB A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 31 1 HOH HOH A . B 2 HOH 2 32 2 HOH HOH A . B 2 HOH 3 33 3 HOH HOH A . B 2 HOH 4 34 4 HOH HOH A . B 2 HOH 5 35 5 HOH HOH A . B 2 HOH 6 36 6 HOH HOH A . B 2 HOH 7 37 7 HOH HOH A . B 2 HOH 8 38 8 HOH HOH A . B 2 HOH 9 39 9 HOH HOH A . B 2 HOH 10 40 10 HOH HOH A . B 2 HOH 11 41 11 HOH HOH A . B 2 HOH 12 42 12 HOH HOH A . B 2 HOH 13 43 13 HOH HOH A . B 2 HOH 14 44 14 HOH HOH A . B 2 HOH 15 45 15 HOH HOH A . B 2 HOH 16 46 16 HOH HOH A . B 2 HOH 17 47 17 HOH HOH A . B 2 HOH 18 48 18 HOH HOH A . B 2 HOH 19 49 19 HOH HOH A . B 2 HOH 20 50 20 HOH HOH A . B 2 HOH 21 51 21 HOH HOH A . B 2 HOH 22 52 22 HOH HOH A . B 2 HOH 23 53 23 HOH HOH A . B 2 HOH 24 54 24 HOH HOH A . B 2 HOH 25 55 25 HOH HOH A . B 2 HOH 26 56 26 HOH HOH A . B 2 HOH 27 57 27 HOH HOH A . B 2 HOH 28 58 28 HOH HOH A . B 2 HOH 29 59 29 HOH HOH A . B 2 HOH 30 60 30 HOH HOH A . B 2 HOH 31 61 31 HOH HOH A . B 2 HOH 32 62 32 HOH HOH A . B 2 HOH 33 63 33 HOH HOH A . B 2 HOH 34 64 34 HOH HOH A . B 2 HOH 35 65 35 HOH HOH A . B 2 HOH 36 66 36 HOH HOH A . B 2 HOH 37 67 37 HOH HOH A . B 2 HOH 38 68 38 HOH HOH A . B 2 HOH 39 69 39 HOH HOH A . B 2 HOH 40 70 40 HOH HOH A . B 2 HOH 41 71 41 HOH HOH A . B 2 HOH 42 72 42 HOH HOH A . B 2 HOH 43 73 43 HOH HOH A . B 2 HOH 44 74 44 HOH HOH A . B 2 HOH 45 75 45 HOH HOH A . B 2 HOH 46 76 46 HOH HOH A . B 2 HOH 47 77 47 HOH HOH A . B 2 HOH 48 78 48 HOH HOH A . B 2 HOH 49 79 49 HOH HOH A . B 2 HOH 50 80 50 HOH HOH A . B 2 HOH 51 81 51 HOH HOH A . B 2 HOH 52 82 52 HOH HOH A . B 2 HOH 53 83 53 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 HKL-2000 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 PHASER phasing . ? 5 # _cell.entry_id 2PM1 _cell.length_a 38.811 _cell.length_b 38.811 _cell.length_c 31.560 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2PM1 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # _exptl.entry_id 2PM1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_percent_sol 41.17 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.2 M sodium citrate, 0.1 M HEPES, 20 (v/v/) iso-Propanol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2007-03-10 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.96 # _reflns.entry_id 2PM1 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 1.6 _reflns.d_resolution_low 30 _reflns.number_all 3787 _reflns.number_obs 3787 _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_Rsym_value 0.077 _reflns.pdbx_netI_over_sigmaI 16.7 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.6 _reflns_shell.d_res_low 1.66 _reflns_shell.percent_possible_all 98.7 _reflns_shell.Rmerge_I_obs 0.405 _reflns_shell.pdbx_Rsym_value 0.405 _reflns_shell.meanI_over_sigI_obs 2.8 _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 374 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2PM1 _refine.ls_number_reflns_obs 3602 _refine.ls_number_reflns_all 3787 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.60 _refine.ls_percent_reflns_obs 98.51 _refine.ls_R_factor_obs 0.15363 _refine.ls_R_factor_all 0.15363 _refine.ls_R_factor_R_work 0.15128 _refine.ls_R_factor_R_free 0.20087 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 168 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.B_iso_mean 24.406 _refine.aniso_B[1][1] -0.07 _refine.aniso_B[2][2] -0.07 _refine.aniso_B[3][3] 0.10 _refine.aniso_B[1][2] -0.03 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 1DFN _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.125 _refine.pdbx_overall_ESU_R_Free 0.091 _refine.overall_SU_ML 0.065 _refine.overall_SU_B 4.341 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2PM1 _refine_analyze.Luzzati_coordinate_error_obs 0.1831 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 226 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 279 _refine_hist.d_res_high 1.60 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.022 ? 235 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.959 1.980 ? 320 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.449 5.000 ? 29 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 12.376 21.250 ? 8 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 11.931 15.000 ? 27 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 7.623 15.000 ? 1 'X-RAY DIFFRACTION' ? r_chiral_restr 0.656 0.200 ? 32 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 178 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.227 0.200 ? 97 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.307 0.200 ? 165 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.242 0.200 ? 30 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.283 0.200 ? 23 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.378 0.200 ? 21 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.725 1.500 ? 152 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.686 2.000 ? 233 'X-RAY DIFFRACTION' ? r_scbond_it 3.920 3.000 ? 104 'X-RAY DIFFRACTION' ? r_scangle_it 4.149 4.500 ? 87 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 3.464 3.000 ? 256 'X-RAY DIFFRACTION' ? r_sphericity_free 6.687 3.000 ? 53 'X-RAY DIFFRACTION' ? r_sphericity_bonded 4.295 3.000 ? 226 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.601 _refine_ls_shell.d_res_low 1.643 _refine_ls_shell.number_reflns_R_work 258 _refine_ls_shell.R_factor_R_work 0.193 _refine_ls_shell.percent_reflns_obs 98.91 _refine_ls_shell.R_factor_R_free 0.29 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 15 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 2PM1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2PM1 _struct.title 'Derivative of human alpha-defensin 1 (HNP1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PM1 _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'antimicrobial, defensin derivative, ANTIMICROBIAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF1_HUMAN _struct_ref.pdbx_db_accession P59665 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ACYCRIPACIAGERRYGTCIYQGRLWAFCC _struct_ref.pdbx_align_begin 65 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PM1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P59665 _struct_ref_seq.db_align_beg 65 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 94 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2PM1 DAB A 14 ? UNP P59665 ARG 78 'engineered mutation' 14 1 1 2PM1 DAB A 15 ? UNP P59665 ARG 79 'engineered mutation' 15 2 1 2PM1 DAB A 24 ? UNP P59665 ARG 88 'engineered mutation' 24 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 2 A CYS 30 1_555 ? ? ? ? ? ? ? 2.065 ? ? disulf2 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 19 SG ? ? A CYS 4 A CYS 19 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf3 disulf ? ? A CYS 9 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 9 A CYS 29 1_555 ? ? ? ? ? ? ? 2.014 ? ? covale1 covale both ? A GLU 13 C ? ? ? 1_555 A DAB 14 N ? ? A GLU 13 A DAB 14 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A DAB 14 C ? ? ? 1_555 A DAB 15 N ? ? A DAB 14 A DAB 15 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? A DAB 15 C ? ? ? 1_555 A TYR 16 N ? ? A DAB 15 A TYR 16 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale4 covale both ? A GLY 23 C ? ? ? 1_555 A DAB 24 N ? ? A GLY 23 A DAB 24 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale5 covale both ? A DAB 24 C ? ? ? 1_555 A LEU 25 N ? ? A DAB 24 A LEU 25 1_555 ? ? ? ? ? ? ? 1.324 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 DAB A 14 ? . . . . DAB A 14 ? 1_555 . . . . . . . ALA 1 DAB None 'Non-standard residue' 2 DAB A 15 ? . . . . DAB A 15 ? 1_555 . . . . . . . ALA 1 DAB None 'Non-standard residue' 3 DAB A 24 ? . . . . DAB A 24 ? 1_555 . . . . . . . ALA 1 DAB None 'Non-standard residue' 4 CYS A 2 ? CYS A 30 ? CYS A 2 ? 1_555 CYS A 30 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 4 ? CYS A 19 ? CYS A 4 ? 1_555 CYS A 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 9 ? CYS A 29 ? CYS A 9 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 6 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 6 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 7 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 7 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.41 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 3 ? ARG A 5 ? TYR A 3 ARG A 5 A 2 DAB A 24 ? CYS A 30 ? DAB A 24 CYS A 30 A 3 DAB A 14 ? TYR A 21 ? DAB A 14 TYR A 21 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 5 ? N ARG A 5 O ALA A 27 ? O ALA A 27 A 2 3 O CYS A 30 ? O CYS A 30 N DAB A 14 ? N DAB A 14 # _pdbx_entry_details.entry_id 2PM1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 34 ? ? O A HOH 61 ? ? 1.95 2 1 O A HOH 52 ? ? O A HOH 55 ? ? 2.13 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 40 ? ? 1_555 O A HOH 82 ? ? 3_655 1.81 2 1 O A HOH 44 ? ? 1_555 O A HOH 44 ? ? 6_555 1.83 3 1 O A HOH 55 ? ? 1_555 O A HOH 66 ? ? 3_654 2.19 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CB _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id THR _pdbx_validate_chiral.auth_seq_id 18 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A DAB 14 A DAB 14 ? ALA '2,4-DIAMINOBUTYRIC ACID' 2 A DAB 15 A DAB 15 ? ALA '2,4-DIAMINOBUTYRIC ACID' 3 A DAB 24 A DAB 24 ? ALA '2,4-DIAMINOBUTYRIC ACID' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 CYS N N N N 41 CYS CA C N R 42 CYS C C N N 43 CYS O O N N 44 CYS CB C N N 45 CYS SG S N N 46 CYS OXT O N N 47 CYS H H N N 48 CYS H2 H N N 49 CYS HA H N N 50 CYS HB2 H N N 51 CYS HB3 H N N 52 CYS HG H N N 53 CYS HXT H N N 54 DAB N N N N 55 DAB CA C N S 56 DAB C C N N 57 DAB O O N N 58 DAB CB C N N 59 DAB CG C N N 60 DAB ND N N N 61 DAB OXT O N N 62 DAB H H N N 63 DAB H2 H N N 64 DAB HA H N N 65 DAB HB2 H N N 66 DAB HB3 H N N 67 DAB HG2 H N N 68 DAB HG3 H N N 69 DAB HD1 H N N 70 DAB HD2 H N N 71 DAB HXT H N N 72 GLN N N N N 73 GLN CA C N S 74 GLN C C N N 75 GLN O O N N 76 GLN CB C N N 77 GLN CG C N N 78 GLN CD C N N 79 GLN OE1 O N N 80 GLN NE2 N N N 81 GLN OXT O N N 82 GLN H H N N 83 GLN H2 H N N 84 GLN HA H N N 85 GLN HB2 H N N 86 GLN HB3 H N N 87 GLN HG2 H N N 88 GLN HG3 H N N 89 GLN HE21 H N N 90 GLN HE22 H N N 91 GLN HXT H N N 92 GLU N N N N 93 GLU CA C N S 94 GLU C C N N 95 GLU O O N N 96 GLU CB C N N 97 GLU CG C N N 98 GLU CD C N N 99 GLU OE1 O N N 100 GLU OE2 O N N 101 GLU OXT O N N 102 GLU H H N N 103 GLU H2 H N N 104 GLU HA H N N 105 GLU HB2 H N N 106 GLU HB3 H N N 107 GLU HG2 H N N 108 GLU HG3 H N N 109 GLU HE2 H N N 110 GLU HXT H N N 111 GLY N N N N 112 GLY CA C N N 113 GLY C C N N 114 GLY O O N N 115 GLY OXT O N N 116 GLY H H N N 117 GLY H2 H N N 118 GLY HA2 H N N 119 GLY HA3 H N N 120 GLY HXT H N N 121 HOH O O N N 122 HOH H1 H N N 123 HOH H2 H N N 124 ILE N N N N 125 ILE CA C N S 126 ILE C C N N 127 ILE O O N N 128 ILE CB C N S 129 ILE CG1 C N N 130 ILE CG2 C N N 131 ILE CD1 C N N 132 ILE OXT O N N 133 ILE H H N N 134 ILE H2 H N N 135 ILE HA H N N 136 ILE HB H N N 137 ILE HG12 H N N 138 ILE HG13 H N N 139 ILE HG21 H N N 140 ILE HG22 H N N 141 ILE HG23 H N N 142 ILE HD11 H N N 143 ILE HD12 H N N 144 ILE HD13 H N N 145 ILE HXT H N N 146 LEU N N N N 147 LEU CA C N S 148 LEU C C N N 149 LEU O O N N 150 LEU CB C N N 151 LEU CG C N N 152 LEU CD1 C N N 153 LEU CD2 C N N 154 LEU OXT O N N 155 LEU H H N N 156 LEU H2 H N N 157 LEU HA H N N 158 LEU HB2 H N N 159 LEU HB3 H N N 160 LEU HG H N N 161 LEU HD11 H N N 162 LEU HD12 H N N 163 LEU HD13 H N N 164 LEU HD21 H N N 165 LEU HD22 H N N 166 LEU HD23 H N N 167 LEU HXT H N N 168 PHE N N N N 169 PHE CA C N S 170 PHE C C N N 171 PHE O O N N 172 PHE CB C N N 173 PHE CG C Y N 174 PHE CD1 C Y N 175 PHE CD2 C Y N 176 PHE CE1 C Y N 177 PHE CE2 C Y N 178 PHE CZ C Y N 179 PHE OXT O N N 180 PHE H H N N 181 PHE H2 H N N 182 PHE HA H N N 183 PHE HB2 H N N 184 PHE HB3 H N N 185 PHE HD1 H N N 186 PHE HD2 H N N 187 PHE HE1 H N N 188 PHE HE2 H N N 189 PHE HZ H N N 190 PHE HXT H N N 191 PRO N N N N 192 PRO CA C N S 193 PRO C C N N 194 PRO O O N N 195 PRO CB C N N 196 PRO CG C N N 197 PRO CD C N N 198 PRO OXT O N N 199 PRO H H N N 200 PRO HA H N N 201 PRO HB2 H N N 202 PRO HB3 H N N 203 PRO HG2 H N N 204 PRO HG3 H N N 205 PRO HD2 H N N 206 PRO HD3 H N N 207 PRO HXT H N N 208 THR N N N N 209 THR CA C N S 210 THR C C N N 211 THR O O N N 212 THR CB C N R 213 THR OG1 O N N 214 THR CG2 C N N 215 THR OXT O N N 216 THR H H N N 217 THR H2 H N N 218 THR HA H N N 219 THR HB H N N 220 THR HG1 H N N 221 THR HG21 H N N 222 THR HG22 H N N 223 THR HG23 H N N 224 THR HXT H N N 225 TRP N N N N 226 TRP CA C N S 227 TRP C C N N 228 TRP O O N N 229 TRP CB C N N 230 TRP CG C Y N 231 TRP CD1 C Y N 232 TRP CD2 C Y N 233 TRP NE1 N Y N 234 TRP CE2 C Y N 235 TRP CE3 C Y N 236 TRP CZ2 C Y N 237 TRP CZ3 C Y N 238 TRP CH2 C Y N 239 TRP OXT O N N 240 TRP H H N N 241 TRP H2 H N N 242 TRP HA H N N 243 TRP HB2 H N N 244 TRP HB3 H N N 245 TRP HD1 H N N 246 TRP HE1 H N N 247 TRP HE3 H N N 248 TRP HZ2 H N N 249 TRP HZ3 H N N 250 TRP HH2 H N N 251 TRP HXT H N N 252 TYR N N N N 253 TYR CA C N S 254 TYR C C N N 255 TYR O O N N 256 TYR CB C N N 257 TYR CG C Y N 258 TYR CD1 C Y N 259 TYR CD2 C Y N 260 TYR CE1 C Y N 261 TYR CE2 C Y N 262 TYR CZ C Y N 263 TYR OH O N N 264 TYR OXT O N N 265 TYR H H N N 266 TYR H2 H N N 267 TYR HA H N N 268 TYR HB2 H N N 269 TYR HB3 H N N 270 TYR HD1 H N N 271 TYR HD2 H N N 272 TYR HE1 H N N 273 TYR HE2 H N N 274 TYR HH H N N 275 TYR HXT H N N 276 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 CYS N CA sing N N 39 CYS N H sing N N 40 CYS N H2 sing N N 41 CYS CA C sing N N 42 CYS CA CB sing N N 43 CYS CA HA sing N N 44 CYS C O doub N N 45 CYS C OXT sing N N 46 CYS CB SG sing N N 47 CYS CB HB2 sing N N 48 CYS CB HB3 sing N N 49 CYS SG HG sing N N 50 CYS OXT HXT sing N N 51 DAB N CA sing N N 52 DAB N H sing N N 53 DAB N H2 sing N N 54 DAB CA C sing N N 55 DAB CA CB sing N N 56 DAB CA HA sing N N 57 DAB C O doub N N 58 DAB C OXT sing N N 59 DAB CB CG sing N N 60 DAB CB HB2 sing N N 61 DAB CB HB3 sing N N 62 DAB CG ND sing N N 63 DAB CG HG2 sing N N 64 DAB CG HG3 sing N N 65 DAB ND HD1 sing N N 66 DAB ND HD2 sing N N 67 DAB OXT HXT sing N N 68 GLN N CA sing N N 69 GLN N H sing N N 70 GLN N H2 sing N N 71 GLN CA C sing N N 72 GLN CA CB sing N N 73 GLN CA HA sing N N 74 GLN C O doub N N 75 GLN C OXT sing N N 76 GLN CB CG sing N N 77 GLN CB HB2 sing N N 78 GLN CB HB3 sing N N 79 GLN CG CD sing N N 80 GLN CG HG2 sing N N 81 GLN CG HG3 sing N N 82 GLN CD OE1 doub N N 83 GLN CD NE2 sing N N 84 GLN NE2 HE21 sing N N 85 GLN NE2 HE22 sing N N 86 GLN OXT HXT sing N N 87 GLU N CA sing N N 88 GLU N H sing N N 89 GLU N H2 sing N N 90 GLU CA C sing N N 91 GLU CA CB sing N N 92 GLU CA HA sing N N 93 GLU C O doub N N 94 GLU C OXT sing N N 95 GLU CB CG sing N N 96 GLU CB HB2 sing N N 97 GLU CB HB3 sing N N 98 GLU CG CD sing N N 99 GLU CG HG2 sing N N 100 GLU CG HG3 sing N N 101 GLU CD OE1 doub N N 102 GLU CD OE2 sing N N 103 GLU OE2 HE2 sing N N 104 GLU OXT HXT sing N N 105 GLY N CA sing N N 106 GLY N H sing N N 107 GLY N H2 sing N N 108 GLY CA C sing N N 109 GLY CA HA2 sing N N 110 GLY CA HA3 sing N N 111 GLY C O doub N N 112 GLY C OXT sing N N 113 GLY OXT HXT sing N N 114 HOH O H1 sing N N 115 HOH O H2 sing N N 116 ILE N CA sing N N 117 ILE N H sing N N 118 ILE N H2 sing N N 119 ILE CA C sing N N 120 ILE CA CB sing N N 121 ILE CA HA sing N N 122 ILE C O doub N N 123 ILE C OXT sing N N 124 ILE CB CG1 sing N N 125 ILE CB CG2 sing N N 126 ILE CB HB sing N N 127 ILE CG1 CD1 sing N N 128 ILE CG1 HG12 sing N N 129 ILE CG1 HG13 sing N N 130 ILE CG2 HG21 sing N N 131 ILE CG2 HG22 sing N N 132 ILE CG2 HG23 sing N N 133 ILE CD1 HD11 sing N N 134 ILE CD1 HD12 sing N N 135 ILE CD1 HD13 sing N N 136 ILE OXT HXT sing N N 137 LEU N CA sing N N 138 LEU N H sing N N 139 LEU N H2 sing N N 140 LEU CA C sing N N 141 LEU CA CB sing N N 142 LEU CA HA sing N N 143 LEU C O doub N N 144 LEU C OXT sing N N 145 LEU CB CG sing N N 146 LEU CB HB2 sing N N 147 LEU CB HB3 sing N N 148 LEU CG CD1 sing N N 149 LEU CG CD2 sing N N 150 LEU CG HG sing N N 151 LEU CD1 HD11 sing N N 152 LEU CD1 HD12 sing N N 153 LEU CD1 HD13 sing N N 154 LEU CD2 HD21 sing N N 155 LEU CD2 HD22 sing N N 156 LEU CD2 HD23 sing N N 157 LEU OXT HXT sing N N 158 PHE N CA sing N N 159 PHE N H sing N N 160 PHE N H2 sing N N 161 PHE CA C sing N N 162 PHE CA CB sing N N 163 PHE CA HA sing N N 164 PHE C O doub N N 165 PHE C OXT sing N N 166 PHE CB CG sing N N 167 PHE CB HB2 sing N N 168 PHE CB HB3 sing N N 169 PHE CG CD1 doub Y N 170 PHE CG CD2 sing Y N 171 PHE CD1 CE1 sing Y N 172 PHE CD1 HD1 sing N N 173 PHE CD2 CE2 doub Y N 174 PHE CD2 HD2 sing N N 175 PHE CE1 CZ doub Y N 176 PHE CE1 HE1 sing N N 177 PHE CE2 CZ sing Y N 178 PHE CE2 HE2 sing N N 179 PHE CZ HZ sing N N 180 PHE OXT HXT sing N N 181 PRO N CA sing N N 182 PRO N CD sing N N 183 PRO N H sing N N 184 PRO CA C sing N N 185 PRO CA CB sing N N 186 PRO CA HA sing N N 187 PRO C O doub N N 188 PRO C OXT sing N N 189 PRO CB CG sing N N 190 PRO CB HB2 sing N N 191 PRO CB HB3 sing N N 192 PRO CG CD sing N N 193 PRO CG HG2 sing N N 194 PRO CG HG3 sing N N 195 PRO CD HD2 sing N N 196 PRO CD HD3 sing N N 197 PRO OXT HXT sing N N 198 THR N CA sing N N 199 THR N H sing N N 200 THR N H2 sing N N 201 THR CA C sing N N 202 THR CA CB sing N N 203 THR CA HA sing N N 204 THR C O doub N N 205 THR C OXT sing N N 206 THR CB OG1 sing N N 207 THR CB CG2 sing N N 208 THR CB HB sing N N 209 THR OG1 HG1 sing N N 210 THR CG2 HG21 sing N N 211 THR CG2 HG22 sing N N 212 THR CG2 HG23 sing N N 213 THR OXT HXT sing N N 214 TRP N CA sing N N 215 TRP N H sing N N 216 TRP N H2 sing N N 217 TRP CA C sing N N 218 TRP CA CB sing N N 219 TRP CA HA sing N N 220 TRP C O doub N N 221 TRP C OXT sing N N 222 TRP CB CG sing N N 223 TRP CB HB2 sing N N 224 TRP CB HB3 sing N N 225 TRP CG CD1 doub Y N 226 TRP CG CD2 sing Y N 227 TRP CD1 NE1 sing Y N 228 TRP CD1 HD1 sing N N 229 TRP CD2 CE2 doub Y N 230 TRP CD2 CE3 sing Y N 231 TRP NE1 CE2 sing Y N 232 TRP NE1 HE1 sing N N 233 TRP CE2 CZ2 sing Y N 234 TRP CE3 CZ3 doub Y N 235 TRP CE3 HE3 sing N N 236 TRP CZ2 CH2 doub Y N 237 TRP CZ2 HZ2 sing N N 238 TRP CZ3 CH2 sing Y N 239 TRP CZ3 HZ3 sing N N 240 TRP CH2 HH2 sing N N 241 TRP OXT HXT sing N N 242 TYR N CA sing N N 243 TYR N H sing N N 244 TYR N H2 sing N N 245 TYR CA C sing N N 246 TYR CA CB sing N N 247 TYR CA HA sing N N 248 TYR C O doub N N 249 TYR C OXT sing N N 250 TYR CB CG sing N N 251 TYR CB HB2 sing N N 252 TYR CB HB3 sing N N 253 TYR CG CD1 doub Y N 254 TYR CG CD2 sing Y N 255 TYR CD1 CE1 sing Y N 256 TYR CD1 HD1 sing N N 257 TYR CD2 CE2 doub Y N 258 TYR CD2 HD2 sing N N 259 TYR CE1 CZ doub Y N 260 TYR CE1 HE1 sing N N 261 TYR CE2 CZ sing Y N 262 TYR CE2 HE2 sing N N 263 TYR CZ OH sing N N 264 TYR OH HH sing N N 265 TYR OXT HXT sing N N 266 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1DFN _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 2PM1 _atom_sites.fract_transf_matrix[1][1] 0.025766 _atom_sites.fract_transf_matrix[1][2] 0.014876 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029752 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031686 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_