data_2Q4M # _entry.id 2Q4M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2Q4M pdb_00002q4m 10.2210/pdb2q4m/pdb RCSB RCSB043142 ? ? WWPDB D_1000043142 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-19 2 'Structure model' 1 1 2007-09-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2011-08-10 5 'Structure model' 1 4 2023-08-30 6 'Structure model' 1 5 2023-11-15 7 'Structure model' 1 6 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Other 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' 8 6 'Structure model' 'Data collection' 9 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_initial_refinement_model 5 5 'Structure model' struct_conn 6 5 'Structure model' struct_ref_seq_dif 7 5 'Structure model' struct_site 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 7 'Structure model' pdbx_entry_details 11 7 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 5 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 5 'Structure model' '_struct_site.pdbx_auth_seq_id' 8 6 'Structure model' '_chem_comp_atom.atom_id' 9 6 'Structure model' '_chem_comp_bond.atom_id_2' # _pdbx_database_status.entry_id 2Q4M _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-31 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB GO.24556 . unspecified PDB 1ZXU 'Original refinement based on same data and R-free set.' re-refinement # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Levin, E.J.' 1 'Kondrashov, D.A.' 2 'Wesenberg, G.E.' 3 'Phillips Jr., G.N.' 4 'Center for Eukaryotic Structural Genomics (CESG)' 5 # _citation.id primary _citation.title 'Ensemble refinement of protein crystal structures: validation and application.' _citation.journal_abbrev Structure _citation.journal_volume 15 _citation.page_first 1040 _citation.page_last 1052 _citation.year 2007 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17850744 _citation.pdbx_database_id_DOI 10.1016/j.str.2007.06.019 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Levin, E.J.' 1 ? primary 'Kondrashov, D.A.' 2 ? primary 'Wesenberg, G.E.' 3 ? primary 'Phillips, G.N.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein At5g01750' 24702.094 1 ? ? ? ? 2 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 3 water nat water 18.015 127 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)EQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPID(MSE)AIVRK(MSE)(MSE)SLTDGNFVITDVNGNLL FKVKEPVFGLHDKRVLLDGSGTPVVTLREK(MSE)VS(MSE)HDRWQVFRGGSTDQRDLLYTVKRSS(MSE)LQLKTKLD VFLGHNKDEKRCDFRVKGSWLERSCVVYAGESDAIVAQ(MSE)HRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILD DVNREDRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRKMMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVL LDGSGTPVVTLREKMVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVY AGESDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDVNREDRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier GO.24556 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 GLN n 1 4 PRO n 1 5 TYR n 1 6 VAL n 1 7 TYR n 1 8 ALA n 1 9 TYR n 1 10 PRO n 1 11 GLN n 1 12 GLY n 1 13 SER n 1 14 GLY n 1 15 PRO n 1 16 SER n 1 17 GLY n 1 18 ALA n 1 19 PRO n 1 20 THR n 1 21 PRO n 1 22 GLN n 1 23 ALA n 1 24 GLY n 1 25 GLY n 1 26 VAL n 1 27 VAL n 1 28 VAL n 1 29 ASP n 1 30 PRO n 1 31 LYS n 1 32 TYR n 1 33 CYS n 1 34 ALA n 1 35 PRO n 1 36 TYR n 1 37 PRO n 1 38 ILE n 1 39 ASP n 1 40 MSE n 1 41 ALA n 1 42 ILE n 1 43 VAL n 1 44 ARG n 1 45 LYS n 1 46 MSE n 1 47 MSE n 1 48 SER n 1 49 LEU n 1 50 THR n 1 51 ASP n 1 52 GLY n 1 53 ASN n 1 54 PHE n 1 55 VAL n 1 56 ILE n 1 57 THR n 1 58 ASP n 1 59 VAL n 1 60 ASN n 1 61 GLY n 1 62 ASN n 1 63 LEU n 1 64 LEU n 1 65 PHE n 1 66 LYS n 1 67 VAL n 1 68 LYS n 1 69 GLU n 1 70 PRO n 1 71 VAL n 1 72 PHE n 1 73 GLY n 1 74 LEU n 1 75 HIS n 1 76 ASP n 1 77 LYS n 1 78 ARG n 1 79 VAL n 1 80 LEU n 1 81 LEU n 1 82 ASP n 1 83 GLY n 1 84 SER n 1 85 GLY n 1 86 THR n 1 87 PRO n 1 88 VAL n 1 89 VAL n 1 90 THR n 1 91 LEU n 1 92 ARG n 1 93 GLU n 1 94 LYS n 1 95 MSE n 1 96 VAL n 1 97 SER n 1 98 MSE n 1 99 HIS n 1 100 ASP n 1 101 ARG n 1 102 TRP n 1 103 GLN n 1 104 VAL n 1 105 PHE n 1 106 ARG n 1 107 GLY n 1 108 GLY n 1 109 SER n 1 110 THR n 1 111 ASP n 1 112 GLN n 1 113 ARG n 1 114 ASP n 1 115 LEU n 1 116 LEU n 1 117 TYR n 1 118 THR n 1 119 VAL n 1 120 LYS n 1 121 ARG n 1 122 SER n 1 123 SER n 1 124 MSE n 1 125 LEU n 1 126 GLN n 1 127 LEU n 1 128 LYS n 1 129 THR n 1 130 LYS n 1 131 LEU n 1 132 ASP n 1 133 VAL n 1 134 PHE n 1 135 LEU n 1 136 GLY n 1 137 HIS n 1 138 ASN n 1 139 LYS n 1 140 ASP n 1 141 GLU n 1 142 LYS n 1 143 ARG n 1 144 CYS n 1 145 ASP n 1 146 PHE n 1 147 ARG n 1 148 VAL n 1 149 LYS n 1 150 GLY n 1 151 SER n 1 152 TRP n 1 153 LEU n 1 154 GLU n 1 155 ARG n 1 156 SER n 1 157 CYS n 1 158 VAL n 1 159 VAL n 1 160 TYR n 1 161 ALA n 1 162 GLY n 1 163 GLU n 1 164 SER n 1 165 ASP n 1 166 ALA n 1 167 ILE n 1 168 VAL n 1 169 ALA n 1 170 GLN n 1 171 MSE n 1 172 HIS n 1 173 ARG n 1 174 LYS n 1 175 HIS n 1 176 THR n 1 177 VAL n 1 178 GLN n 1 179 SER n 1 180 VAL n 1 181 PHE n 1 182 LEU n 1 183 GLY n 1 184 LYS n 1 185 ASP n 1 186 ASN n 1 187 PHE n 1 188 SER n 1 189 VAL n 1 190 THR n 1 191 VAL n 1 192 TYR n 1 193 PRO n 1 194 ASN n 1 195 VAL n 1 196 ASP n 1 197 TYR n 1 198 ALA n 1 199 PHE n 1 200 ILE n 1 201 ALA n 1 202 SER n 1 203 LEU n 1 204 VAL n 1 205 VAL n 1 206 ILE n 1 207 LEU n 1 208 ASP n 1 209 ASP n 1 210 VAL n 1 211 ASN n 1 212 ARG n 1 213 GLU n 1 214 ASP n 1 215 ARG n 1 216 ALA n 1 217 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene 'At5g01750, T20L15.20' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'cv. Columbia' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL834(DE3) PLACI+RARE' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PVP-13 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 TYR 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 TYR 9 9 ? ? ? A . n A 1 10 PRO 10 10 ? ? ? A . n A 1 11 GLN 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 GLY 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 SER 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 ALA 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 THR 20 20 ? ? ? A . n A 1 21 PRO 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 MSE 40 40 40 MSE MSE A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MSE 46 46 ? ? ? A . n A 1 47 MSE 47 47 ? ? ? A . n A 1 48 SER 48 48 ? ? ? A . n A 1 49 LEU 49 49 ? ? ? A . n A 1 50 THR 50 50 ? ? ? A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 LYS 94 94 ? ? ? A . n A 1 95 MSE 95 95 ? ? ? A . n A 1 96 VAL 96 96 ? ? ? A . n A 1 97 SER 97 97 ? ? ? A . n A 1 98 MSE 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 TRP 102 102 102 TRP TRP A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 TYR 117 117 117 TYR TYR A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 SER 122 122 ? ? ? A . n A 1 123 SER 123 123 ? ? ? A . n A 1 124 MSE 124 124 ? ? ? A . n A 1 125 LEU 125 125 ? ? ? A . n A 1 126 GLN 126 126 ? ? ? A . n A 1 127 LEU 127 127 ? ? ? A . n A 1 128 LYS 128 128 ? ? ? A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLU 141 141 ? ? ? A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 CYS 157 157 157 CYS CYS A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 VAL 168 168 168 VAL VAL A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 GLN 170 170 170 GLN GLN A . n A 1 171 MSE 171 171 171 MSE MSE A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 HIS 175 175 ? ? ? A . n A 1 176 THR 176 176 ? ? ? A . n A 1 177 VAL 177 177 ? ? ? A . n A 1 178 GLN 178 178 ? ? ? A . n A 1 179 SER 179 179 ? ? ? A . n A 1 180 VAL 180 180 ? ? ? A . n A 1 181 PHE 181 181 ? ? ? A . n A 1 182 LEU 182 182 ? ? ? A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ASN 186 186 186 ASN ASN A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 TYR 192 192 192 TYR TYR A . n A 1 193 PRO 193 193 193 PRO PRO A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 TYR 197 197 197 TYR TYR A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 PHE 199 199 199 PHE PHE A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 LEU 207 207 207 LEU LEU A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 GLU 213 213 ? ? ? A . n A 1 214 ASP 214 214 ? ? ? A . n A 1 215 ARG 215 215 ? ? ? A . n A 1 216 ALA 216 216 ? ? ? A . n A 1 217 ALA 217 217 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 700 700 EDO EDO A . C 3 HOH 1 701 1 HOH HOH A . C 3 HOH 2 702 2 HOH HOH A . C 3 HOH 3 703 3 HOH HOH A . C 3 HOH 4 704 4 HOH HOH A . C 3 HOH 5 705 5 HOH HOH A . C 3 HOH 6 706 6 HOH HOH A . C 3 HOH 7 707 7 HOH HOH A . C 3 HOH 8 708 8 HOH HOH A . C 3 HOH 9 709 9 HOH HOH A . C 3 HOH 10 710 10 HOH HOH A . C 3 HOH 11 711 11 HOH HOH A . C 3 HOH 12 712 12 HOH HOH A . C 3 HOH 13 713 13 HOH HOH A . C 3 HOH 14 714 14 HOH HOH A . C 3 HOH 15 715 15 HOH HOH A . C 3 HOH 16 716 16 HOH HOH A . C 3 HOH 17 717 17 HOH HOH A . C 3 HOH 18 718 18 HOH HOH A . C 3 HOH 19 719 19 HOH HOH A . C 3 HOH 20 720 20 HOH HOH A . C 3 HOH 21 721 21 HOH HOH A . C 3 HOH 22 722 22 HOH HOH A . C 3 HOH 23 723 23 HOH HOH A . C 3 HOH 24 724 24 HOH HOH A . C 3 HOH 25 725 25 HOH HOH A . C 3 HOH 26 726 26 HOH HOH A . C 3 HOH 27 727 27 HOH HOH A . C 3 HOH 28 728 28 HOH HOH A . C 3 HOH 29 729 29 HOH HOH A . C 3 HOH 30 730 30 HOH HOH A . C 3 HOH 31 731 31 HOH HOH A . C 3 HOH 32 732 32 HOH HOH A . C 3 HOH 33 733 33 HOH HOH A . C 3 HOH 34 734 34 HOH HOH A . C 3 HOH 35 735 35 HOH HOH A . C 3 HOH 36 736 36 HOH HOH A . C 3 HOH 37 737 37 HOH HOH A . C 3 HOH 38 738 38 HOH HOH A . C 3 HOH 39 739 39 HOH HOH A . C 3 HOH 40 740 40 HOH HOH A . C 3 HOH 41 741 41 HOH HOH A . C 3 HOH 42 742 42 HOH HOH A . C 3 HOH 43 743 43 HOH HOH A . C 3 HOH 44 744 44 HOH HOH A . C 3 HOH 45 745 45 HOH HOH A . C 3 HOH 46 746 46 HOH HOH A . C 3 HOH 47 747 47 HOH HOH A . C 3 HOH 48 748 48 HOH HOH A . C 3 HOH 49 749 49 HOH HOH A . C 3 HOH 50 750 50 HOH HOH A . C 3 HOH 51 751 51 HOH HOH A . C 3 HOH 52 752 52 HOH HOH A . C 3 HOH 53 753 53 HOH HOH A . C 3 HOH 54 754 54 HOH HOH A . C 3 HOH 55 755 55 HOH HOH A . C 3 HOH 56 756 56 HOH HOH A . C 3 HOH 57 757 57 HOH HOH A . C 3 HOH 58 758 58 HOH HOH A . C 3 HOH 59 759 59 HOH HOH A . C 3 HOH 60 760 60 HOH HOH A . C 3 HOH 61 761 61 HOH HOH A . C 3 HOH 62 762 62 HOH HOH A . C 3 HOH 63 763 63 HOH HOH A . C 3 HOH 64 764 64 HOH HOH A . C 3 HOH 65 765 65 HOH HOH A . C 3 HOH 66 766 66 HOH HOH A . C 3 HOH 67 767 67 HOH HOH A . C 3 HOH 68 768 68 HOH HOH A . C 3 HOH 69 769 69 HOH HOH A . C 3 HOH 70 770 70 HOH HOH A . C 3 HOH 71 771 71 HOH HOH A . C 3 HOH 72 772 72 HOH HOH A . C 3 HOH 73 773 73 HOH HOH A . C 3 HOH 74 774 74 HOH HOH A . C 3 HOH 75 775 75 HOH HOH A . C 3 HOH 76 776 76 HOH HOH A . C 3 HOH 77 777 77 HOH HOH A . C 3 HOH 78 778 78 HOH HOH A . C 3 HOH 79 779 79 HOH HOH A . C 3 HOH 80 780 80 HOH HOH A . C 3 HOH 81 781 81 HOH HOH A . C 3 HOH 82 782 82 HOH HOH A . C 3 HOH 83 783 83 HOH HOH A . C 3 HOH 84 784 84 HOH HOH A . C 3 HOH 85 785 85 HOH HOH A . C 3 HOH 86 786 86 HOH HOH A . C 3 HOH 87 787 87 HOH HOH A . C 3 HOH 88 788 88 HOH HOH A . C 3 HOH 89 789 89 HOH HOH A . C 3 HOH 90 790 90 HOH HOH A . C 3 HOH 91 791 91 HOH HOH A . C 3 HOH 92 792 92 HOH HOH A . C 3 HOH 93 793 93 HOH HOH A . C 3 HOH 94 794 94 HOH HOH A . C 3 HOH 95 795 95 HOH HOH A . C 3 HOH 96 796 96 HOH HOH A . C 3 HOH 97 797 97 HOH HOH A . C 3 HOH 98 798 98 HOH HOH A . C 3 HOH 99 799 99 HOH HOH A . C 3 HOH 100 800 100 HOH HOH A . C 3 HOH 101 801 101 HOH HOH A . C 3 HOH 102 802 102 HOH HOH A . C 3 HOH 103 803 103 HOH HOH A . C 3 HOH 104 804 104 HOH HOH A . C 3 HOH 105 805 105 HOH HOH A . C 3 HOH 106 806 106 HOH HOH A . C 3 HOH 107 807 107 HOH HOH A . C 3 HOH 108 808 108 HOH HOH A . C 3 HOH 109 809 109 HOH HOH A . C 3 HOH 110 810 111 HOH HOH A . C 3 HOH 111 811 112 HOH HOH A . C 3 HOH 112 812 113 HOH HOH A . C 3 HOH 113 813 114 HOH HOH A . C 3 HOH 114 814 115 HOH HOH A . C 3 HOH 115 815 116 HOH HOH A . C 3 HOH 116 816 117 HOH HOH A . C 3 HOH 117 817 118 HOH HOH A . C 3 HOH 118 818 119 HOH HOH A . C 3 HOH 119 819 120 HOH HOH A . C 3 HOH 120 820 121 HOH HOH A . C 3 HOH 121 821 122 HOH HOH A . C 3 HOH 122 822 123 HOH HOH A . C 3 HOH 123 823 124 HOH HOH A . C 3 HOH 124 824 125 HOH HOH A . C 3 HOH 125 825 126 HOH HOH A . C 3 HOH 126 826 127 HOH HOH A . C 3 HOH 127 827 128 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal CNS 1.1 ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 1 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 CNS 1.1 ? ? ? ? phasing ? ? ? 3 # _cell.entry_id 2Q4M _cell.length_a 41.066 _cell.length_b 57.499 _cell.length_c 75.359 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2Q4M _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 19 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number ? _exptl.entry_id 2Q4M _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_percent_sol 31.7 _exptl_crystal.density_Matthews 1.80 _exptl_crystal.density_meas ? _exptl_crystal.description 'AUTHOR USED THE SF DATA FROM ENTRY 1ZXU.' _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 2Q4M _refine.pdbx_starting_model 'PDB entry 1ZXU' _refine.pdbx_method_to_determine_struct 'Re-refinement using ensemble model' _refine.pdbx_stereochemistry_target_values 'maximum likelihood using amplitudes' _refine.ls_d_res_high 1.700 _refine.ls_d_res_low 37.680 _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF 1125214.625 _refine.pdbx_data_cutoff_low_absF 0.000 _refine.ls_percent_reflns_obs 99.700 _refine.ls_number_reflns_obs 20236 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details ;This PDB entry is a re-refinement using an ensemble model of the previously deposited single-conformer structure 1zxu and the first data set in the deposited structure factor file for 1zxu along with the R-free set defined therein. The coordinates were generated by an automated protocol from an initial model consisting of 16 identical copies of the protein and non-water hetero-atoms assigned fractional occupancies adding up to one, and a single copy of the solvent molecules. Refinement was carried out with all the conformers present simultaneously and with the potential energy terms corresponding to interactions between the different conformers excluded. The helix and sheet records were calculated using coordinates from the first conformer only. The structure visualization program PYMOL is well-suited for directly viewing the ensemble model presented in this PDB file. ; _refine.ls_R_factor_R_work 0.158 _refine.ls_R_factor_R_free 0.207 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 1036 _refine.ls_R_factor_R_free_error 0.006 _refine.B_iso_mean 21.600 _refine.solvent_model_param_bsol 60.275 _refine.solvent_model_param_ksol 0.381 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.aniso_B[1][1] -0.060 _refine.aniso_B[2][2] 0.530 _refine.aniso_B[3][3] -0.470 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'FLAT MODEL' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.158 _refine.ls_redundancy_reflns_obs ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2Q4M _refine_analyze.Luzzati_coordinate_error_obs 0.130 _refine_analyze.Luzzati_sigma_a_obs -0.040 _refine_analyze.Luzzati_d_res_low_obs 5.000 _refine_analyze.Luzzati_coordinate_error_free 0.190 _refine_analyze.Luzzati_sigma_a_free 0.100 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1287 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 127 _refine_hist.number_atoms_total 1418 _refine_hist.d_res_high 1.700 _refine_hist.d_res_low 37.680 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d ? 0.021 ? ? 'X-RAY DIFFRACTION' ? c_angle_deg ? 2.000 ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? 26.000 ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? 1.280 ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? 1.900 1.500 ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? 2.890 2.000 ? 'X-RAY DIFFRACTION' ? c_scbond_it ? 2.790 2.000 ? 'X-RAY DIFFRACTION' ? c_scangle_it ? 4.180 2.500 ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.R_factor_all _refine_ls_shell.pdbx_refine_id 6 1.70 1.81 3311 3287 3115 99.3 0.184 0.259 0.020 172 5.2 . . 'X-RAY DIFFRACTION' 6 1.81 1.95 3327 3324 3144 99.9 0.137 0.195 0.015 180 5.4 . . 'X-RAY DIFFRACTION' 6 1.95 2.14 3351 3347 3177 99.9 0.130 0.213 0.016 170 5.1 . . 'X-RAY DIFFRACTION' 6 2.14 2.45 3347 3345 3158 99.9 0.137 0.198 0.014 187 5.6 . . 'X-RAY DIFFRACTION' 6 2.45 3.09 3385 3384 3212 100.0 0.153 0.199 0.015 172 5.1 . . 'X-RAY DIFFRACTION' 6 3.09 37.68 3557 3549 3394 99.7 0.176 0.210 0.017 155 4.4 . . 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 water_rep.param water.top 'X-RAY DIFFRACTION' 3 edo.param ? 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 2Q4M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _struct.entry_id 2Q4M _struct.title 'Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At5g01750' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.text ;Ensemble Refinement, Refinement Methodology Development, AT5G01750, PFAM PF01167, TULP, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION ; _struct_keywords.entry_id 2Q4M _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y5175_ARATH _struct_ref.pdbx_db_accession Q9LZX1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRKMMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVL LDGSGTPVVTLREKMVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVY AGESDAIVAQMHRKHTVQSVFLGKDNFSVTVYPNVDYAFIASLVVILDDVNREDRAA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Q4M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9LZX1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 217 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 217 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2Q4M MSE A 1 ? UNP Q9LZX1 MET 1 'modified residue' 1 1 1 2Q4M MSE A 40 ? UNP Q9LZX1 MET 40 'modified residue' 40 2 1 2Q4M MSE A 46 ? UNP Q9LZX1 MET 46 'modified residue' 46 3 1 2Q4M MSE A 47 ? UNP Q9LZX1 MET 47 'modified residue' 47 4 1 2Q4M MSE A 95 ? UNP Q9LZX1 MET 95 'modified residue' 95 5 1 2Q4M MSE A 98 ? UNP Q9LZX1 MET 98 'modified residue' 98 6 1 2Q4M MSE A 124 ? UNP Q9LZX1 MET 124 'modified residue' 124 7 1 2Q4M MSE A 171 ? UNP Q9LZX1 MET 171 'modified residue' 171 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 29 ? CYS A 33 ? ASP A 29 CYS A 33 5 ? 5 HELX_P HELX_P2 2 ASP A 111 ? ARG A 113 ? ASP A 111 ARG A 113 5 ? 3 HELX_P HELX_P3 3 GLU A 163 ? ASP A 165 ? GLU A 163 ASP A 165 5 ? 3 HELX_P HELX_P4 4 ASP A 196 ? ARG A 212 ? ASP A 196 ARG A 212 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 39 C ? ? ? 1_555 A MSE 40 N ? ? A ASP 39 A MSE 40 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 40 C ? ? ? 1_555 A ALA 41 N ? ? A MSE 40 A ALA 41 1_555 ? ? ? ? ? ? ? 1.359 ? ? covale3 covale both ? A GLN 170 C ? ? ? 1_555 A MSE 171 N ? ? A GLN 170 A MSE 171 1_555 ? ? ? ? ? ? ? 1.319 ? ? covale4 covale both ? A MSE 171 C ? ? ? 1_555 A HIS 172 N ? ? A MSE 171 A HIS 172 1_555 ? ? ? ? ? ? ? 1.347 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 40 ? . . . . MSE A 40 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 171 ? . . . . MSE A 171 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 13 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel A 9 10 ? anti-parallel A 10 11 ? anti-parallel A 11 12 ? anti-parallel A 12 13 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 38 ? VAL A 43 ? ILE A 38 VAL A 43 A 2 PHE A 54 ? ASP A 58 ? PHE A 54 ASP A 58 A 3 LEU A 63 ? LYS A 68 ? LEU A 63 LYS A 68 A 4 LYS A 77 ? LEU A 81 ? LYS A 77 LEU A 81 A 5 PRO A 87 ? ARG A 92 ? PRO A 87 ARG A 92 A 6 ARG A 101 ? ARG A 106 ? ARG A 101 ARG A 106 A 7 LEU A 115 ? LYS A 120 ? LEU A 115 LYS A 120 A 8 LEU A 131 ? LEU A 135 ? LEU A 131 LEU A 135 A 9 PHE A 146 ? LYS A 149 ? PHE A 146 LYS A 149 A 10 VAL A 158 ? ALA A 161 ? VAL A 158 ALA A 161 A 11 ILE A 167 ? ARG A 173 ? ILE A 167 ARG A 173 A 12 PHE A 187 ? VAL A 191 ? PHE A 187 VAL A 191 A 13 ILE A 38 ? VAL A 43 ? ILE A 38 VAL A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 43 ? N VAL A 43 O VAL A 55 ? O VAL A 55 A 2 3 N ILE A 56 ? N ILE A 56 O PHE A 65 ? O PHE A 65 A 3 4 N LYS A 66 ? N LYS A 66 O LEU A 81 ? O LEU A 81 A 4 5 N LEU A 80 ? N LEU A 80 O VAL A 88 ? O VAL A 88 A 5 6 N THR A 90 ? N THR A 90 O PHE A 105 ? O PHE A 105 A 6 7 N TRP A 102 ? N TRP A 102 O VAL A 119 ? O VAL A 119 A 7 8 N THR A 118 ? N THR A 118 O PHE A 134 ? O PHE A 134 A 8 9 N VAL A 133 ? N VAL A 133 O PHE A 146 ? O PHE A 146 A 9 10 N ARG A 147 ? N ARG A 147 O TYR A 160 ? O TYR A 160 A 10 11 N VAL A 159 ? N VAL A 159 O VAL A 168 ? O VAL A 168 A 11 12 N GLN A 170 ? N GLN A 170 O THR A 190 ? O THR A 190 A 12 13 O VAL A 191 ? O VAL A 191 N ILE A 38 ? N ILE A 38 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EDO _struct_site.pdbx_auth_seq_id 700 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE EDO A 700' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 GLY A 83 ? GLY A 83 . ? 1_555 ? 2 AC1 2 LYS A 174 ? LYS A 174 . ? 4_555 ? # _pdbx_entry_details.entry_id 2Q4M _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CD1 A TYR 117 ? ? CE1 A TYR 117 ? ? 1.480 1.389 0.091 0.015 N 2 8 CB A VAL 104 ? ? CG2 A VAL 104 ? ? 1.656 1.524 0.132 0.021 N 3 9 CD1 A TYR 117 ? ? CE1 A TYR 117 ? ? 1.487 1.389 0.098 0.015 N 4 13 CA A VAL 79 ? ? CB A VAL 79 ? ? 1.743 1.543 0.200 0.021 N 5 13 CD1 A TYR 117 ? ? CE1 A TYR 117 ? ? 1.492 1.389 0.103 0.015 N 6 14 CD1 A TYR 117 ? ? CE1 A TYR 117 ? ? 1.505 1.389 0.116 0.015 N 7 14 CB A CYS 157 ? ? SG A CYS 157 ? ? 1.968 1.818 0.150 0.017 N 8 15 CE1 A TYR 117 ? ? CZ A TYR 117 ? ? 1.470 1.381 0.089 0.013 N 9 15 CB A VAL 133 ? ? CG2 A VAL 133 ? ? 1.652 1.524 0.128 0.021 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A MSE 40 ? ? CG A MSE 40 ? ? SE A MSE 40 ? ? 87.93 112.70 -24.77 3.00 N 2 2 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.33 120.30 3.03 0.50 N 3 2 N A ARG 143 ? ? CA A ARG 143 ? ? C A ARG 143 ? ? 127.32 111.00 16.32 2.70 N 4 3 CB A ASP 196 ? ? CG A ASP 196 ? ? OD1 A ASP 196 ? ? 112.24 118.30 -6.06 0.90 N 5 9 CA A CYS 33 ? ? CB A CYS 33 ? ? SG A CYS 33 ? ? 121.96 114.20 7.76 1.10 N 6 10 CA A LEU 63 ? ? CB A LEU 63 ? ? CG A LEU 63 ? ? 101.47 115.30 -13.83 2.30 N 7 13 CA A LEU 80 ? ? CB A LEU 80 ? ? CG A LEU 80 ? ? 91.73 115.30 -23.57 2.30 N 8 14 C A GLU 69 ? ? N A PRO 70 ? ? CA A PRO 70 ? ? 108.98 119.30 -10.32 1.50 Y 9 14 CB A TYR 117 ? ? CG A TYR 117 ? ? CD2 A TYR 117 ? ? 117.24 121.00 -3.76 0.60 N 10 14 CA A CYS 157 ? ? CB A CYS 157 ? ? SG A CYS 157 ? ? 126.26 114.20 12.06 1.10 N 11 15 CB A TYR 117 ? ? CG A TYR 117 ? ? CD2 A TYR 117 ? ? 115.45 121.00 -5.55 0.60 N 12 15 OH A TYR 117 ? ? CZ A TYR 117 ? ? CE2 A TYR 117 ? ? 101.18 120.10 -18.92 2.70 N 13 16 CA A LEU 80 ? ? CB A LEU 80 ? ? CG A LEU 80 ? ? 99.61 115.30 -15.69 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 27 ? ? -126.51 -53.13 2 1 TYR A 32 ? ? -90.01 38.23 3 1 LYS A 130 ? ? -84.95 -75.49 4 1 GLU A 163 ? ? -51.83 31.50 5 1 SER A 164 ? ? -157.54 -25.77 6 1 ASN A 186 ? ? -72.11 47.53 7 1 PRO A 193 ? ? -39.49 137.75 8 2 ASP A 29 ? ? -175.45 142.27 9 2 TYR A 192 ? ? -30.80 148.21 10 3 VAL A 27 ? ? -139.32 -44.91 11 3 ILE A 38 ? ? -153.52 77.82 12 3 THR A 110 ? ? -142.72 15.29 13 3 SER A 164 ? ? -170.70 8.04 14 3 ASN A 186 ? ? -72.71 46.47 15 3 ASN A 194 ? ? 71.16 -5.21 16 4 VAL A 27 ? ? -140.55 -39.05 17 4 PHE A 72 ? ? -30.33 118.68 18 4 HIS A 75 ? ? -68.06 0.60 19 4 SER A 109 ? ? 174.16 172.65 20 4 LYS A 149 ? ? -105.96 -166.18 21 4 ALA A 166 ? ? -67.75 -160.59 22 4 ALA A 169 ? ? 45.05 149.79 23 4 ASN A 186 ? ? -72.05 43.51 24 5 VAL A 27 ? ? -140.18 -33.64 25 5 ASN A 60 ? ? -74.04 23.08 26 5 THR A 110 ? ? -156.12 4.78 27 5 LYS A 149 ? ? -119.91 -169.56 28 5 ARG A 155 ? ? 71.86 42.55 29 5 SER A 164 ? ? -164.85 -25.99 30 5 ASN A 186 ? ? -90.39 54.62 31 5 PHE A 187 ? ? -176.19 149.08 32 5 PRO A 193 ? ? -37.09 137.20 33 6 VAL A 27 ? ? -143.04 -34.15 34 6 LYS A 139 ? ? -102.73 74.08 35 6 CYS A 144 ? ? -42.01 156.52 36 6 GLU A 163 ? ? -57.20 -8.16 37 6 SER A 164 ? ? -173.87 0.09 38 6 ASN A 186 ? ? -86.99 49.92 39 7 VAL A 27 ? ? -129.32 -51.84 40 7 LEU A 135 ? ? -58.29 175.40 41 7 CYS A 144 ? ? -113.33 -96.71 42 7 ASP A 145 ? ? -128.01 -86.34 43 7 ASP A 185 ? ? -29.94 145.99 44 7 ASN A 186 ? ? -83.79 49.33 45 8 VAL A 27 ? ? -137.65 -46.52 46 8 ARG A 78 ? ? -165.84 83.90 47 8 GLU A 163 ? ? -93.10 36.65 48 8 SER A 164 ? ? -161.51 -22.96 49 8 ASN A 186 ? ? -75.96 42.78 50 8 PRO A 193 ? ? -35.92 137.51 51 9 VAL A 27 ? ? -136.76 -43.69 52 9 LYS A 68 ? ? 172.23 154.01 53 9 HIS A 75 ? ? -140.97 44.14 54 9 PRO A 87 ? ? -51.13 -178.14 55 9 VAL A 88 ? ? -155.41 -50.19 56 9 VAL A 89 ? ? -167.65 112.25 57 9 LYS A 130 ? ? -66.25 -74.01 58 9 SER A 151 ? ? -177.78 111.52 59 9 ASP A 165 ? ? 51.74 76.41 60 9 ASN A 186 ? ? -76.24 45.01 61 10 VAL A 27 ? ? -135.72 -50.67 62 10 ASP A 29 ? ? -177.89 137.31 63 10 ASP A 58 ? ? -87.55 -90.18 64 10 SER A 109 ? ? 159.08 157.75 65 10 ASN A 186 ? ? -80.92 47.20 66 11 VAL A 27 ? ? -123.71 -59.36 67 11 ASP A 29 ? ? 176.20 129.89 68 11 PRO A 35 ? ? -68.93 0.74 69 11 LEU A 64 ? ? -96.28 -69.70 70 11 ASN A 186 ? ? -83.14 34.29 71 11 ASN A 194 ? ? 80.03 8.96 72 12 VAL A 27 ? ? -126.18 -52.88 73 12 SER A 109 ? ? 173.70 156.58 74 12 LEU A 115 ? ? -30.60 126.11 75 12 GLU A 163 ? ? -38.36 -16.93 76 12 SER A 164 ? ? -144.77 -9.22 77 12 ASN A 186 ? ? -83.92 36.91 78 13 ASP A 29 ? ? -177.90 138.03 79 13 VAL A 59 ? ? -67.55 4.39 80 13 LEU A 80 ? ? -36.13 116.84 81 13 GLU A 163 ? ? -50.82 48.23 82 13 SER A 164 ? ? -177.99 -30.99 83 14 VAL A 27 ? ? -136.38 -45.62 84 14 ASP A 29 ? ? 177.68 145.52 85 14 LYS A 130 ? ? -129.39 -73.63 86 14 SER A 164 ? ? -162.83 27.49 87 14 ASN A 186 ? ? -77.62 29.68 88 15 VAL A 27 ? ? -140.75 -46.57 89 15 ASP A 29 ? ? 179.67 137.23 90 15 PHE A 54 ? ? 179.95 167.55 91 15 LEU A 64 ? ? -101.41 -62.43 92 15 VAL A 88 ? ? -100.13 -61.22 93 15 ARG A 101 ? ? -162.15 105.46 94 15 SER A 164 ? ? -155.90 -24.17 95 15 ASP A 185 ? ? -37.19 154.20 96 15 VAL A 204 ? ? -26.82 -48.89 97 15 ILE A 206 ? ? -63.83 6.72 98 15 ASN A 211 ? ? -55.10 8.37 99 16 VAL A 27 ? ? -151.77 -14.58 100 16 VAL A 28 ? ? -146.44 -46.38 101 16 TYR A 32 ? ? -96.67 34.99 102 16 PHE A 54 ? ? 173.08 169.09 103 16 LYS A 139 ? ? -89.76 46.08 104 16 GLU A 163 ? ? -39.74 -23.41 105 16 ALA A 169 ? ? 94.49 143.73 106 16 ASN A 186 ? ? -84.59 35.75 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 PHE A 72 ? ? 0.113 'SIDE CHAIN' 2 2 TYR A 192 ? ? 0.065 'SIDE CHAIN' 3 6 TYR A 192 ? ? 0.117 'SIDE CHAIN' 4 11 TYR A 192 ? ? 0.085 'SIDE CHAIN' 5 15 TYR A 36 ? ? 0.068 'SIDE CHAIN' 6 15 TYR A 197 ? ? 0.081 'SIDE CHAIN' 7 16 TYR A 197 ? ? 0.123 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Center for Eukaryotic Structural Genomics' _pdbx_SG_project.initial_of_center CESG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 40 A MSE 40 ? MET SELENOMETHIONINE 2 A MSE 171 A MSE 171 ? MET SELENOMETHIONINE # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A TYR 7 ? A TYR 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A TYR 9 ? A TYR 9 10 1 Y 1 A PRO 10 ? A PRO 10 11 1 Y 1 A GLN 11 ? A GLN 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A GLY 14 ? A GLY 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A SER 16 ? A SER 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A ALA 18 ? A ALA 18 19 1 Y 1 A PRO 19 ? A PRO 19 20 1 Y 1 A THR 20 ? A THR 20 21 1 Y 1 A PRO 21 ? A PRO 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A MSE 46 ? A MSE 46 25 1 Y 1 A MSE 47 ? A MSE 47 26 1 Y 1 A SER 48 ? A SER 48 27 1 Y 1 A LEU 49 ? A LEU 49 28 1 Y 1 A THR 50 ? A THR 50 29 1 Y 1 A LYS 94 ? A LYS 94 30 1 Y 1 A MSE 95 ? A MSE 95 31 1 Y 1 A VAL 96 ? A VAL 96 32 1 Y 1 A SER 97 ? A SER 97 33 1 Y 1 A MSE 98 ? A MSE 98 34 1 Y 1 A HIS 99 ? A HIS 99 35 1 Y 1 A SER 122 ? A SER 122 36 1 Y 1 A SER 123 ? A SER 123 37 1 Y 1 A MSE 124 ? A MSE 124 38 1 Y 1 A LEU 125 ? A LEU 125 39 1 Y 1 A GLN 126 ? A GLN 126 40 1 Y 1 A LEU 127 ? A LEU 127 41 1 Y 1 A LYS 128 ? A LYS 128 42 1 Y 1 A GLU 141 ? A GLU 141 43 1 Y 1 A HIS 175 ? A HIS 175 44 1 Y 1 A THR 176 ? A THR 176 45 1 Y 1 A VAL 177 ? A VAL 177 46 1 Y 1 A GLN 178 ? A GLN 178 47 1 Y 1 A SER 179 ? A SER 179 48 1 Y 1 A VAL 180 ? A VAL 180 49 1 Y 1 A PHE 181 ? A PHE 181 50 1 Y 1 A LEU 182 ? A LEU 182 51 1 Y 1 A GLU 213 ? A GLU 213 52 1 Y 1 A ASP 214 ? A ASP 214 53 1 Y 1 A ARG 215 ? A ARG 215 54 1 Y 1 A ALA 216 ? A ALA 216 55 1 Y 1 A ALA 217 ? A ALA 217 56 2 Y 1 A MSE 1 ? A MSE 1 57 2 Y 1 A GLU 2 ? A GLU 2 58 2 Y 1 A GLN 3 ? A GLN 3 59 2 Y 1 A PRO 4 ? A PRO 4 60 2 Y 1 A TYR 5 ? A TYR 5 61 2 Y 1 A VAL 6 ? A VAL 6 62 2 Y 1 A TYR 7 ? A TYR 7 63 2 Y 1 A ALA 8 ? A ALA 8 64 2 Y 1 A TYR 9 ? A TYR 9 65 2 Y 1 A PRO 10 ? A PRO 10 66 2 Y 1 A GLN 11 ? A GLN 11 67 2 Y 1 A GLY 12 ? A GLY 12 68 2 Y 1 A SER 13 ? A SER 13 69 2 Y 1 A GLY 14 ? A GLY 14 70 2 Y 1 A PRO 15 ? A PRO 15 71 2 Y 1 A SER 16 ? A SER 16 72 2 Y 1 A GLY 17 ? A GLY 17 73 2 Y 1 A ALA 18 ? A ALA 18 74 2 Y 1 A PRO 19 ? A PRO 19 75 2 Y 1 A THR 20 ? A THR 20 76 2 Y 1 A PRO 21 ? A PRO 21 77 2 Y 1 A GLN 22 ? A GLN 22 78 2 Y 1 A ALA 23 ? A ALA 23 79 2 Y 1 A MSE 46 ? A MSE 46 80 2 Y 1 A MSE 47 ? A MSE 47 81 2 Y 1 A SER 48 ? A SER 48 82 2 Y 1 A LEU 49 ? A LEU 49 83 2 Y 1 A THR 50 ? A THR 50 84 2 Y 1 A LYS 94 ? A LYS 94 85 2 Y 1 A MSE 95 ? A MSE 95 86 2 Y 1 A VAL 96 ? A VAL 96 87 2 Y 1 A SER 97 ? A SER 97 88 2 Y 1 A MSE 98 ? A MSE 98 89 2 Y 1 A HIS 99 ? A HIS 99 90 2 Y 1 A SER 122 ? A SER 122 91 2 Y 1 A SER 123 ? A SER 123 92 2 Y 1 A MSE 124 ? A MSE 124 93 2 Y 1 A LEU 125 ? A LEU 125 94 2 Y 1 A GLN 126 ? A GLN 126 95 2 Y 1 A LEU 127 ? A LEU 127 96 2 Y 1 A LYS 128 ? A LYS 128 97 2 Y 1 A GLU 141 ? A GLU 141 98 2 Y 1 A HIS 175 ? A HIS 175 99 2 Y 1 A THR 176 ? A THR 176 100 2 Y 1 A VAL 177 ? A VAL 177 101 2 Y 1 A GLN 178 ? A GLN 178 102 2 Y 1 A SER 179 ? A SER 179 103 2 Y 1 A VAL 180 ? A VAL 180 104 2 Y 1 A PHE 181 ? A PHE 181 105 2 Y 1 A LEU 182 ? A LEU 182 106 2 Y 1 A GLU 213 ? A GLU 213 107 2 Y 1 A ASP 214 ? A ASP 214 108 2 Y 1 A ARG 215 ? A ARG 215 109 2 Y 1 A ALA 216 ? A ALA 216 110 2 Y 1 A ALA 217 ? A ALA 217 111 3 Y 1 A MSE 1 ? A MSE 1 112 3 Y 1 A GLU 2 ? A GLU 2 113 3 Y 1 A GLN 3 ? A GLN 3 114 3 Y 1 A PRO 4 ? A PRO 4 115 3 Y 1 A TYR 5 ? A TYR 5 116 3 Y 1 A VAL 6 ? A VAL 6 117 3 Y 1 A TYR 7 ? A TYR 7 118 3 Y 1 A ALA 8 ? A ALA 8 119 3 Y 1 A TYR 9 ? A TYR 9 120 3 Y 1 A PRO 10 ? A PRO 10 121 3 Y 1 A GLN 11 ? A GLN 11 122 3 Y 1 A GLY 12 ? A GLY 12 123 3 Y 1 A SER 13 ? A SER 13 124 3 Y 1 A GLY 14 ? A GLY 14 125 3 Y 1 A PRO 15 ? A PRO 15 126 3 Y 1 A SER 16 ? A SER 16 127 3 Y 1 A GLY 17 ? A GLY 17 128 3 Y 1 A ALA 18 ? A ALA 18 129 3 Y 1 A PRO 19 ? A PRO 19 130 3 Y 1 A THR 20 ? A THR 20 131 3 Y 1 A PRO 21 ? A PRO 21 132 3 Y 1 A GLN 22 ? A GLN 22 133 3 Y 1 A ALA 23 ? A ALA 23 134 3 Y 1 A MSE 46 ? A MSE 46 135 3 Y 1 A MSE 47 ? A MSE 47 136 3 Y 1 A SER 48 ? A SER 48 137 3 Y 1 A LEU 49 ? A LEU 49 138 3 Y 1 A THR 50 ? A THR 50 139 3 Y 1 A LYS 94 ? A LYS 94 140 3 Y 1 A MSE 95 ? A MSE 95 141 3 Y 1 A VAL 96 ? A VAL 96 142 3 Y 1 A SER 97 ? A SER 97 143 3 Y 1 A MSE 98 ? A MSE 98 144 3 Y 1 A HIS 99 ? A HIS 99 145 3 Y 1 A SER 122 ? A SER 122 146 3 Y 1 A SER 123 ? A SER 123 147 3 Y 1 A MSE 124 ? A MSE 124 148 3 Y 1 A LEU 125 ? A LEU 125 149 3 Y 1 A GLN 126 ? A GLN 126 150 3 Y 1 A LEU 127 ? A LEU 127 151 3 Y 1 A LYS 128 ? A LYS 128 152 3 Y 1 A GLU 141 ? A GLU 141 153 3 Y 1 A HIS 175 ? A HIS 175 154 3 Y 1 A THR 176 ? A THR 176 155 3 Y 1 A VAL 177 ? A VAL 177 156 3 Y 1 A GLN 178 ? A GLN 178 157 3 Y 1 A SER 179 ? A SER 179 158 3 Y 1 A VAL 180 ? A VAL 180 159 3 Y 1 A PHE 181 ? A PHE 181 160 3 Y 1 A LEU 182 ? A LEU 182 161 3 Y 1 A GLU 213 ? A GLU 213 162 3 Y 1 A ASP 214 ? A ASP 214 163 3 Y 1 A ARG 215 ? A ARG 215 164 3 Y 1 A ALA 216 ? A ALA 216 165 3 Y 1 A ALA 217 ? A ALA 217 166 4 Y 1 A MSE 1 ? A MSE 1 167 4 Y 1 A GLU 2 ? A GLU 2 168 4 Y 1 A GLN 3 ? A GLN 3 169 4 Y 1 A PRO 4 ? A PRO 4 170 4 Y 1 A TYR 5 ? A TYR 5 171 4 Y 1 A VAL 6 ? A VAL 6 172 4 Y 1 A TYR 7 ? A TYR 7 173 4 Y 1 A ALA 8 ? A ALA 8 174 4 Y 1 A TYR 9 ? A TYR 9 175 4 Y 1 A PRO 10 ? A PRO 10 176 4 Y 1 A GLN 11 ? A GLN 11 177 4 Y 1 A GLY 12 ? A GLY 12 178 4 Y 1 A SER 13 ? A SER 13 179 4 Y 1 A GLY 14 ? A GLY 14 180 4 Y 1 A PRO 15 ? A PRO 15 181 4 Y 1 A SER 16 ? A SER 16 182 4 Y 1 A GLY 17 ? A GLY 17 183 4 Y 1 A ALA 18 ? A ALA 18 184 4 Y 1 A PRO 19 ? A PRO 19 185 4 Y 1 A THR 20 ? A THR 20 186 4 Y 1 A PRO 21 ? A PRO 21 187 4 Y 1 A GLN 22 ? A GLN 22 188 4 Y 1 A ALA 23 ? A ALA 23 189 4 Y 1 A MSE 46 ? A MSE 46 190 4 Y 1 A MSE 47 ? A MSE 47 191 4 Y 1 A SER 48 ? A SER 48 192 4 Y 1 A LEU 49 ? A LEU 49 193 4 Y 1 A THR 50 ? A THR 50 194 4 Y 1 A LYS 94 ? A LYS 94 195 4 Y 1 A MSE 95 ? A MSE 95 196 4 Y 1 A VAL 96 ? A VAL 96 197 4 Y 1 A SER 97 ? A SER 97 198 4 Y 1 A MSE 98 ? A MSE 98 199 4 Y 1 A HIS 99 ? A HIS 99 200 4 Y 1 A SER 122 ? A SER 122 201 4 Y 1 A SER 123 ? A SER 123 202 4 Y 1 A MSE 124 ? A MSE 124 203 4 Y 1 A LEU 125 ? A LEU 125 204 4 Y 1 A GLN 126 ? A GLN 126 205 4 Y 1 A LEU 127 ? A LEU 127 206 4 Y 1 A LYS 128 ? A LYS 128 207 4 Y 1 A GLU 141 ? A GLU 141 208 4 Y 1 A HIS 175 ? A HIS 175 209 4 Y 1 A THR 176 ? A THR 176 210 4 Y 1 A VAL 177 ? A VAL 177 211 4 Y 1 A GLN 178 ? A GLN 178 212 4 Y 1 A SER 179 ? A SER 179 213 4 Y 1 A VAL 180 ? A VAL 180 214 4 Y 1 A PHE 181 ? A PHE 181 215 4 Y 1 A LEU 182 ? A LEU 182 216 4 Y 1 A GLU 213 ? A GLU 213 217 4 Y 1 A ASP 214 ? A ASP 214 218 4 Y 1 A ARG 215 ? A ARG 215 219 4 Y 1 A ALA 216 ? A ALA 216 220 4 Y 1 A ALA 217 ? A ALA 217 221 5 Y 1 A MSE 1 ? A MSE 1 222 5 Y 1 A GLU 2 ? A GLU 2 223 5 Y 1 A GLN 3 ? A GLN 3 224 5 Y 1 A PRO 4 ? A PRO 4 225 5 Y 1 A TYR 5 ? A TYR 5 226 5 Y 1 A VAL 6 ? A VAL 6 227 5 Y 1 A TYR 7 ? A TYR 7 228 5 Y 1 A ALA 8 ? A ALA 8 229 5 Y 1 A TYR 9 ? A TYR 9 230 5 Y 1 A PRO 10 ? A PRO 10 231 5 Y 1 A GLN 11 ? A GLN 11 232 5 Y 1 A GLY 12 ? A GLY 12 233 5 Y 1 A SER 13 ? A SER 13 234 5 Y 1 A GLY 14 ? A GLY 14 235 5 Y 1 A PRO 15 ? A PRO 15 236 5 Y 1 A SER 16 ? A SER 16 237 5 Y 1 A GLY 17 ? A GLY 17 238 5 Y 1 A ALA 18 ? A ALA 18 239 5 Y 1 A PRO 19 ? A PRO 19 240 5 Y 1 A THR 20 ? A THR 20 241 5 Y 1 A PRO 21 ? A PRO 21 242 5 Y 1 A GLN 22 ? A GLN 22 243 5 Y 1 A ALA 23 ? A ALA 23 244 5 Y 1 A MSE 46 ? A MSE 46 245 5 Y 1 A MSE 47 ? A MSE 47 246 5 Y 1 A SER 48 ? A SER 48 247 5 Y 1 A LEU 49 ? A LEU 49 248 5 Y 1 A THR 50 ? A THR 50 249 5 Y 1 A LYS 94 ? A LYS 94 250 5 Y 1 A MSE 95 ? A MSE 95 251 5 Y 1 A VAL 96 ? A VAL 96 252 5 Y 1 A SER 97 ? A SER 97 253 5 Y 1 A MSE 98 ? A MSE 98 254 5 Y 1 A HIS 99 ? A HIS 99 255 5 Y 1 A SER 122 ? A SER 122 256 5 Y 1 A SER 123 ? A SER 123 257 5 Y 1 A MSE 124 ? A MSE 124 258 5 Y 1 A LEU 125 ? A LEU 125 259 5 Y 1 A GLN 126 ? A GLN 126 260 5 Y 1 A LEU 127 ? A LEU 127 261 5 Y 1 A LYS 128 ? A LYS 128 262 5 Y 1 A GLU 141 ? A GLU 141 263 5 Y 1 A HIS 175 ? A HIS 175 264 5 Y 1 A THR 176 ? A THR 176 265 5 Y 1 A VAL 177 ? A VAL 177 266 5 Y 1 A GLN 178 ? A GLN 178 267 5 Y 1 A SER 179 ? A SER 179 268 5 Y 1 A VAL 180 ? A VAL 180 269 5 Y 1 A PHE 181 ? A PHE 181 270 5 Y 1 A LEU 182 ? A LEU 182 271 5 Y 1 A GLU 213 ? A GLU 213 272 5 Y 1 A ASP 214 ? A ASP 214 273 5 Y 1 A ARG 215 ? A ARG 215 274 5 Y 1 A ALA 216 ? A ALA 216 275 5 Y 1 A ALA 217 ? A ALA 217 276 6 Y 1 A MSE 1 ? A MSE 1 277 6 Y 1 A GLU 2 ? A GLU 2 278 6 Y 1 A GLN 3 ? A GLN 3 279 6 Y 1 A PRO 4 ? A PRO 4 280 6 Y 1 A TYR 5 ? A TYR 5 281 6 Y 1 A VAL 6 ? A VAL 6 282 6 Y 1 A TYR 7 ? A TYR 7 283 6 Y 1 A ALA 8 ? A ALA 8 284 6 Y 1 A TYR 9 ? A TYR 9 285 6 Y 1 A PRO 10 ? A PRO 10 286 6 Y 1 A GLN 11 ? A GLN 11 287 6 Y 1 A GLY 12 ? A GLY 12 288 6 Y 1 A SER 13 ? A SER 13 289 6 Y 1 A GLY 14 ? A GLY 14 290 6 Y 1 A PRO 15 ? A PRO 15 291 6 Y 1 A SER 16 ? A SER 16 292 6 Y 1 A GLY 17 ? A GLY 17 293 6 Y 1 A ALA 18 ? A ALA 18 294 6 Y 1 A PRO 19 ? A PRO 19 295 6 Y 1 A THR 20 ? A THR 20 296 6 Y 1 A PRO 21 ? A PRO 21 297 6 Y 1 A GLN 22 ? A GLN 22 298 6 Y 1 A ALA 23 ? A ALA 23 299 6 Y 1 A MSE 46 ? A MSE 46 300 6 Y 1 A MSE 47 ? A MSE 47 301 6 Y 1 A SER 48 ? A SER 48 302 6 Y 1 A LEU 49 ? A LEU 49 303 6 Y 1 A THR 50 ? A THR 50 304 6 Y 1 A LYS 94 ? A LYS 94 305 6 Y 1 A MSE 95 ? A MSE 95 306 6 Y 1 A VAL 96 ? A VAL 96 307 6 Y 1 A SER 97 ? A SER 97 308 6 Y 1 A MSE 98 ? A MSE 98 309 6 Y 1 A HIS 99 ? A HIS 99 310 6 Y 1 A SER 122 ? A SER 122 311 6 Y 1 A SER 123 ? A SER 123 312 6 Y 1 A MSE 124 ? A MSE 124 313 6 Y 1 A LEU 125 ? A LEU 125 314 6 Y 1 A GLN 126 ? A GLN 126 315 6 Y 1 A LEU 127 ? A LEU 127 316 6 Y 1 A LYS 128 ? A LYS 128 317 6 Y 1 A GLU 141 ? A GLU 141 318 6 Y 1 A HIS 175 ? A HIS 175 319 6 Y 1 A THR 176 ? A THR 176 320 6 Y 1 A VAL 177 ? A VAL 177 321 6 Y 1 A GLN 178 ? A GLN 178 322 6 Y 1 A SER 179 ? A SER 179 323 6 Y 1 A VAL 180 ? A VAL 180 324 6 Y 1 A PHE 181 ? A PHE 181 325 6 Y 1 A LEU 182 ? A LEU 182 326 6 Y 1 A GLU 213 ? A GLU 213 327 6 Y 1 A ASP 214 ? A ASP 214 328 6 Y 1 A ARG 215 ? A ARG 215 329 6 Y 1 A ALA 216 ? A ALA 216 330 6 Y 1 A ALA 217 ? A ALA 217 331 7 Y 1 A MSE 1 ? A MSE 1 332 7 Y 1 A GLU 2 ? A GLU 2 333 7 Y 1 A GLN 3 ? A GLN 3 334 7 Y 1 A PRO 4 ? A PRO 4 335 7 Y 1 A TYR 5 ? A TYR 5 336 7 Y 1 A VAL 6 ? A VAL 6 337 7 Y 1 A TYR 7 ? A TYR 7 338 7 Y 1 A ALA 8 ? A ALA 8 339 7 Y 1 A TYR 9 ? A TYR 9 340 7 Y 1 A PRO 10 ? A PRO 10 341 7 Y 1 A GLN 11 ? A GLN 11 342 7 Y 1 A GLY 12 ? A GLY 12 343 7 Y 1 A SER 13 ? A SER 13 344 7 Y 1 A GLY 14 ? A GLY 14 345 7 Y 1 A PRO 15 ? A PRO 15 346 7 Y 1 A SER 16 ? A SER 16 347 7 Y 1 A GLY 17 ? A GLY 17 348 7 Y 1 A ALA 18 ? A ALA 18 349 7 Y 1 A PRO 19 ? A PRO 19 350 7 Y 1 A THR 20 ? A THR 20 351 7 Y 1 A PRO 21 ? A PRO 21 352 7 Y 1 A GLN 22 ? A GLN 22 353 7 Y 1 A ALA 23 ? A ALA 23 354 7 Y 1 A MSE 46 ? A MSE 46 355 7 Y 1 A MSE 47 ? A MSE 47 356 7 Y 1 A SER 48 ? A SER 48 357 7 Y 1 A LEU 49 ? A LEU 49 358 7 Y 1 A THR 50 ? A THR 50 359 7 Y 1 A LYS 94 ? A LYS 94 360 7 Y 1 A MSE 95 ? A MSE 95 361 7 Y 1 A VAL 96 ? A VAL 96 362 7 Y 1 A SER 97 ? A SER 97 363 7 Y 1 A MSE 98 ? A MSE 98 364 7 Y 1 A HIS 99 ? A HIS 99 365 7 Y 1 A SER 122 ? A SER 122 366 7 Y 1 A SER 123 ? A SER 123 367 7 Y 1 A MSE 124 ? A MSE 124 368 7 Y 1 A LEU 125 ? A LEU 125 369 7 Y 1 A GLN 126 ? A GLN 126 370 7 Y 1 A LEU 127 ? A LEU 127 371 7 Y 1 A LYS 128 ? A LYS 128 372 7 Y 1 A GLU 141 ? A GLU 141 373 7 Y 1 A HIS 175 ? A HIS 175 374 7 Y 1 A THR 176 ? A THR 176 375 7 Y 1 A VAL 177 ? A VAL 177 376 7 Y 1 A GLN 178 ? A GLN 178 377 7 Y 1 A SER 179 ? A SER 179 378 7 Y 1 A VAL 180 ? A VAL 180 379 7 Y 1 A PHE 181 ? A PHE 181 380 7 Y 1 A LEU 182 ? A LEU 182 381 7 Y 1 A GLU 213 ? A GLU 213 382 7 Y 1 A ASP 214 ? A ASP 214 383 7 Y 1 A ARG 215 ? A ARG 215 384 7 Y 1 A ALA 216 ? A ALA 216 385 7 Y 1 A ALA 217 ? A ALA 217 386 8 Y 1 A MSE 1 ? A MSE 1 387 8 Y 1 A GLU 2 ? A GLU 2 388 8 Y 1 A GLN 3 ? A GLN 3 389 8 Y 1 A PRO 4 ? A PRO 4 390 8 Y 1 A TYR 5 ? A TYR 5 391 8 Y 1 A VAL 6 ? A VAL 6 392 8 Y 1 A TYR 7 ? A TYR 7 393 8 Y 1 A ALA 8 ? A ALA 8 394 8 Y 1 A TYR 9 ? A TYR 9 395 8 Y 1 A PRO 10 ? A PRO 10 396 8 Y 1 A GLN 11 ? A GLN 11 397 8 Y 1 A GLY 12 ? A GLY 12 398 8 Y 1 A SER 13 ? A SER 13 399 8 Y 1 A GLY 14 ? A GLY 14 400 8 Y 1 A PRO 15 ? A PRO 15 401 8 Y 1 A SER 16 ? A SER 16 402 8 Y 1 A GLY 17 ? A GLY 17 403 8 Y 1 A ALA 18 ? A ALA 18 404 8 Y 1 A PRO 19 ? A PRO 19 405 8 Y 1 A THR 20 ? A THR 20 406 8 Y 1 A PRO 21 ? A PRO 21 407 8 Y 1 A GLN 22 ? A GLN 22 408 8 Y 1 A ALA 23 ? A ALA 23 409 8 Y 1 A MSE 46 ? A MSE 46 410 8 Y 1 A MSE 47 ? A MSE 47 411 8 Y 1 A SER 48 ? A SER 48 412 8 Y 1 A LEU 49 ? A LEU 49 413 8 Y 1 A THR 50 ? A THR 50 414 8 Y 1 A LYS 94 ? A LYS 94 415 8 Y 1 A MSE 95 ? A MSE 95 416 8 Y 1 A VAL 96 ? A VAL 96 417 8 Y 1 A SER 97 ? A SER 97 418 8 Y 1 A MSE 98 ? A MSE 98 419 8 Y 1 A HIS 99 ? A HIS 99 420 8 Y 1 A SER 122 ? A SER 122 421 8 Y 1 A SER 123 ? A SER 123 422 8 Y 1 A MSE 124 ? A MSE 124 423 8 Y 1 A LEU 125 ? A LEU 125 424 8 Y 1 A GLN 126 ? A GLN 126 425 8 Y 1 A LEU 127 ? A LEU 127 426 8 Y 1 A LYS 128 ? A LYS 128 427 8 Y 1 A GLU 141 ? A GLU 141 428 8 Y 1 A HIS 175 ? A HIS 175 429 8 Y 1 A THR 176 ? A THR 176 430 8 Y 1 A VAL 177 ? A VAL 177 431 8 Y 1 A GLN 178 ? A GLN 178 432 8 Y 1 A SER 179 ? A SER 179 433 8 Y 1 A VAL 180 ? A VAL 180 434 8 Y 1 A PHE 181 ? A PHE 181 435 8 Y 1 A LEU 182 ? A LEU 182 436 8 Y 1 A GLU 213 ? A GLU 213 437 8 Y 1 A ASP 214 ? A ASP 214 438 8 Y 1 A ARG 215 ? A ARG 215 439 8 Y 1 A ALA 216 ? A ALA 216 440 8 Y 1 A ALA 217 ? A ALA 217 441 9 Y 1 A MSE 1 ? A MSE 1 442 9 Y 1 A GLU 2 ? A GLU 2 443 9 Y 1 A GLN 3 ? A GLN 3 444 9 Y 1 A PRO 4 ? A PRO 4 445 9 Y 1 A TYR 5 ? A TYR 5 446 9 Y 1 A VAL 6 ? A VAL 6 447 9 Y 1 A TYR 7 ? A TYR 7 448 9 Y 1 A ALA 8 ? A ALA 8 449 9 Y 1 A TYR 9 ? A TYR 9 450 9 Y 1 A PRO 10 ? A PRO 10 451 9 Y 1 A GLN 11 ? A GLN 11 452 9 Y 1 A GLY 12 ? A GLY 12 453 9 Y 1 A SER 13 ? A SER 13 454 9 Y 1 A GLY 14 ? A GLY 14 455 9 Y 1 A PRO 15 ? A PRO 15 456 9 Y 1 A SER 16 ? A SER 16 457 9 Y 1 A GLY 17 ? A GLY 17 458 9 Y 1 A ALA 18 ? A ALA 18 459 9 Y 1 A PRO 19 ? A PRO 19 460 9 Y 1 A THR 20 ? A THR 20 461 9 Y 1 A PRO 21 ? A PRO 21 462 9 Y 1 A GLN 22 ? A GLN 22 463 9 Y 1 A ALA 23 ? A ALA 23 464 9 Y 1 A MSE 46 ? A MSE 46 465 9 Y 1 A MSE 47 ? A MSE 47 466 9 Y 1 A SER 48 ? A SER 48 467 9 Y 1 A LEU 49 ? A LEU 49 468 9 Y 1 A THR 50 ? A THR 50 469 9 Y 1 A LYS 94 ? A LYS 94 470 9 Y 1 A MSE 95 ? A MSE 95 471 9 Y 1 A VAL 96 ? A VAL 96 472 9 Y 1 A SER 97 ? A SER 97 473 9 Y 1 A MSE 98 ? A MSE 98 474 9 Y 1 A HIS 99 ? A HIS 99 475 9 Y 1 A SER 122 ? A SER 122 476 9 Y 1 A SER 123 ? A SER 123 477 9 Y 1 A MSE 124 ? A MSE 124 478 9 Y 1 A LEU 125 ? A LEU 125 479 9 Y 1 A GLN 126 ? A GLN 126 480 9 Y 1 A LEU 127 ? A LEU 127 481 9 Y 1 A LYS 128 ? A LYS 128 482 9 Y 1 A GLU 141 ? A GLU 141 483 9 Y 1 A HIS 175 ? A HIS 175 484 9 Y 1 A THR 176 ? A THR 176 485 9 Y 1 A VAL 177 ? A VAL 177 486 9 Y 1 A GLN 178 ? A GLN 178 487 9 Y 1 A SER 179 ? A SER 179 488 9 Y 1 A VAL 180 ? A VAL 180 489 9 Y 1 A PHE 181 ? A PHE 181 490 9 Y 1 A LEU 182 ? A LEU 182 491 9 Y 1 A GLU 213 ? A GLU 213 492 9 Y 1 A ASP 214 ? A ASP 214 493 9 Y 1 A ARG 215 ? A ARG 215 494 9 Y 1 A ALA 216 ? A ALA 216 495 9 Y 1 A ALA 217 ? A ALA 217 496 10 Y 1 A MSE 1 ? A MSE 1 497 10 Y 1 A GLU 2 ? A GLU 2 498 10 Y 1 A GLN 3 ? A GLN 3 499 10 Y 1 A PRO 4 ? A PRO 4 500 10 Y 1 A TYR 5 ? A TYR 5 501 10 Y 1 A VAL 6 ? A VAL 6 502 10 Y 1 A TYR 7 ? A TYR 7 503 10 Y 1 A ALA 8 ? A ALA 8 504 10 Y 1 A TYR 9 ? A TYR 9 505 10 Y 1 A PRO 10 ? A PRO 10 506 10 Y 1 A GLN 11 ? A GLN 11 507 10 Y 1 A GLY 12 ? A GLY 12 508 10 Y 1 A SER 13 ? A SER 13 509 10 Y 1 A GLY 14 ? A GLY 14 510 10 Y 1 A PRO 15 ? A PRO 15 511 10 Y 1 A SER 16 ? A SER 16 512 10 Y 1 A GLY 17 ? A GLY 17 513 10 Y 1 A ALA 18 ? A ALA 18 514 10 Y 1 A PRO 19 ? A PRO 19 515 10 Y 1 A THR 20 ? A THR 20 516 10 Y 1 A PRO 21 ? A PRO 21 517 10 Y 1 A GLN 22 ? A GLN 22 518 10 Y 1 A ALA 23 ? A ALA 23 519 10 Y 1 A MSE 46 ? A MSE 46 520 10 Y 1 A MSE 47 ? A MSE 47 521 10 Y 1 A SER 48 ? A SER 48 522 10 Y 1 A LEU 49 ? A LEU 49 523 10 Y 1 A THR 50 ? A THR 50 524 10 Y 1 A LYS 94 ? A LYS 94 525 10 Y 1 A MSE 95 ? A MSE 95 526 10 Y 1 A VAL 96 ? A VAL 96 527 10 Y 1 A SER 97 ? A SER 97 528 10 Y 1 A MSE 98 ? A MSE 98 529 10 Y 1 A HIS 99 ? A HIS 99 530 10 Y 1 A SER 122 ? A SER 122 531 10 Y 1 A SER 123 ? A SER 123 532 10 Y 1 A MSE 124 ? A MSE 124 533 10 Y 1 A LEU 125 ? A LEU 125 534 10 Y 1 A GLN 126 ? A GLN 126 535 10 Y 1 A LEU 127 ? A LEU 127 536 10 Y 1 A LYS 128 ? A LYS 128 537 10 Y 1 A GLU 141 ? A GLU 141 538 10 Y 1 A HIS 175 ? A HIS 175 539 10 Y 1 A THR 176 ? A THR 176 540 10 Y 1 A VAL 177 ? A VAL 177 541 10 Y 1 A GLN 178 ? A GLN 178 542 10 Y 1 A SER 179 ? A SER 179 543 10 Y 1 A VAL 180 ? A VAL 180 544 10 Y 1 A PHE 181 ? A PHE 181 545 10 Y 1 A LEU 182 ? A LEU 182 546 10 Y 1 A GLU 213 ? A GLU 213 547 10 Y 1 A ASP 214 ? A ASP 214 548 10 Y 1 A ARG 215 ? A ARG 215 549 10 Y 1 A ALA 216 ? A ALA 216 550 10 Y 1 A ALA 217 ? A ALA 217 551 11 Y 1 A MSE 1 ? A MSE 1 552 11 Y 1 A GLU 2 ? A GLU 2 553 11 Y 1 A GLN 3 ? A GLN 3 554 11 Y 1 A PRO 4 ? A PRO 4 555 11 Y 1 A TYR 5 ? A TYR 5 556 11 Y 1 A VAL 6 ? A VAL 6 557 11 Y 1 A TYR 7 ? A TYR 7 558 11 Y 1 A ALA 8 ? A ALA 8 559 11 Y 1 A TYR 9 ? A TYR 9 560 11 Y 1 A PRO 10 ? A PRO 10 561 11 Y 1 A GLN 11 ? A GLN 11 562 11 Y 1 A GLY 12 ? A GLY 12 563 11 Y 1 A SER 13 ? A SER 13 564 11 Y 1 A GLY 14 ? A GLY 14 565 11 Y 1 A PRO 15 ? A PRO 15 566 11 Y 1 A SER 16 ? A SER 16 567 11 Y 1 A GLY 17 ? A GLY 17 568 11 Y 1 A ALA 18 ? A ALA 18 569 11 Y 1 A PRO 19 ? A PRO 19 570 11 Y 1 A THR 20 ? A THR 20 571 11 Y 1 A PRO 21 ? A PRO 21 572 11 Y 1 A GLN 22 ? A GLN 22 573 11 Y 1 A ALA 23 ? A ALA 23 574 11 Y 1 A MSE 46 ? A MSE 46 575 11 Y 1 A MSE 47 ? A MSE 47 576 11 Y 1 A SER 48 ? A SER 48 577 11 Y 1 A LEU 49 ? A LEU 49 578 11 Y 1 A THR 50 ? A THR 50 579 11 Y 1 A LYS 94 ? A LYS 94 580 11 Y 1 A MSE 95 ? A MSE 95 581 11 Y 1 A VAL 96 ? A VAL 96 582 11 Y 1 A SER 97 ? A SER 97 583 11 Y 1 A MSE 98 ? A MSE 98 584 11 Y 1 A HIS 99 ? A HIS 99 585 11 Y 1 A SER 122 ? A SER 122 586 11 Y 1 A SER 123 ? A SER 123 587 11 Y 1 A MSE 124 ? A MSE 124 588 11 Y 1 A LEU 125 ? A LEU 125 589 11 Y 1 A GLN 126 ? A GLN 126 590 11 Y 1 A LEU 127 ? A LEU 127 591 11 Y 1 A LYS 128 ? A LYS 128 592 11 Y 1 A GLU 141 ? A GLU 141 593 11 Y 1 A HIS 175 ? A HIS 175 594 11 Y 1 A THR 176 ? A THR 176 595 11 Y 1 A VAL 177 ? A VAL 177 596 11 Y 1 A GLN 178 ? A GLN 178 597 11 Y 1 A SER 179 ? A SER 179 598 11 Y 1 A VAL 180 ? A VAL 180 599 11 Y 1 A PHE 181 ? A PHE 181 600 11 Y 1 A LEU 182 ? A LEU 182 601 11 Y 1 A GLU 213 ? A GLU 213 602 11 Y 1 A ASP 214 ? A ASP 214 603 11 Y 1 A ARG 215 ? A ARG 215 604 11 Y 1 A ALA 216 ? A ALA 216 605 11 Y 1 A ALA 217 ? A ALA 217 606 12 Y 1 A MSE 1 ? A MSE 1 607 12 Y 1 A GLU 2 ? A GLU 2 608 12 Y 1 A GLN 3 ? A GLN 3 609 12 Y 1 A PRO 4 ? A PRO 4 610 12 Y 1 A TYR 5 ? A TYR 5 611 12 Y 1 A VAL 6 ? A VAL 6 612 12 Y 1 A TYR 7 ? A TYR 7 613 12 Y 1 A ALA 8 ? A ALA 8 614 12 Y 1 A TYR 9 ? A TYR 9 615 12 Y 1 A PRO 10 ? A PRO 10 616 12 Y 1 A GLN 11 ? A GLN 11 617 12 Y 1 A GLY 12 ? A GLY 12 618 12 Y 1 A SER 13 ? A SER 13 619 12 Y 1 A GLY 14 ? A GLY 14 620 12 Y 1 A PRO 15 ? A PRO 15 621 12 Y 1 A SER 16 ? A SER 16 622 12 Y 1 A GLY 17 ? A GLY 17 623 12 Y 1 A ALA 18 ? A ALA 18 624 12 Y 1 A PRO 19 ? A PRO 19 625 12 Y 1 A THR 20 ? A THR 20 626 12 Y 1 A PRO 21 ? A PRO 21 627 12 Y 1 A GLN 22 ? A GLN 22 628 12 Y 1 A ALA 23 ? A ALA 23 629 12 Y 1 A MSE 46 ? A MSE 46 630 12 Y 1 A MSE 47 ? A MSE 47 631 12 Y 1 A SER 48 ? A SER 48 632 12 Y 1 A LEU 49 ? A LEU 49 633 12 Y 1 A THR 50 ? A THR 50 634 12 Y 1 A LYS 94 ? A LYS 94 635 12 Y 1 A MSE 95 ? A MSE 95 636 12 Y 1 A VAL 96 ? A VAL 96 637 12 Y 1 A SER 97 ? A SER 97 638 12 Y 1 A MSE 98 ? A MSE 98 639 12 Y 1 A HIS 99 ? A HIS 99 640 12 Y 1 A SER 122 ? A SER 122 641 12 Y 1 A SER 123 ? A SER 123 642 12 Y 1 A MSE 124 ? A MSE 124 643 12 Y 1 A LEU 125 ? A LEU 125 644 12 Y 1 A GLN 126 ? A GLN 126 645 12 Y 1 A LEU 127 ? A LEU 127 646 12 Y 1 A LYS 128 ? A LYS 128 647 12 Y 1 A GLU 141 ? A GLU 141 648 12 Y 1 A HIS 175 ? A HIS 175 649 12 Y 1 A THR 176 ? A THR 176 650 12 Y 1 A VAL 177 ? A VAL 177 651 12 Y 1 A GLN 178 ? A GLN 178 652 12 Y 1 A SER 179 ? A SER 179 653 12 Y 1 A VAL 180 ? A VAL 180 654 12 Y 1 A PHE 181 ? A PHE 181 655 12 Y 1 A LEU 182 ? A LEU 182 656 12 Y 1 A GLU 213 ? A GLU 213 657 12 Y 1 A ASP 214 ? A ASP 214 658 12 Y 1 A ARG 215 ? A ARG 215 659 12 Y 1 A ALA 216 ? A ALA 216 660 12 Y 1 A ALA 217 ? A ALA 217 661 13 Y 1 A MSE 1 ? A MSE 1 662 13 Y 1 A GLU 2 ? A GLU 2 663 13 Y 1 A GLN 3 ? A GLN 3 664 13 Y 1 A PRO 4 ? A PRO 4 665 13 Y 1 A TYR 5 ? A TYR 5 666 13 Y 1 A VAL 6 ? A VAL 6 667 13 Y 1 A TYR 7 ? A TYR 7 668 13 Y 1 A ALA 8 ? A ALA 8 669 13 Y 1 A TYR 9 ? A TYR 9 670 13 Y 1 A PRO 10 ? A PRO 10 671 13 Y 1 A GLN 11 ? A GLN 11 672 13 Y 1 A GLY 12 ? A GLY 12 673 13 Y 1 A SER 13 ? A SER 13 674 13 Y 1 A GLY 14 ? A GLY 14 675 13 Y 1 A PRO 15 ? A PRO 15 676 13 Y 1 A SER 16 ? A SER 16 677 13 Y 1 A GLY 17 ? A GLY 17 678 13 Y 1 A ALA 18 ? A ALA 18 679 13 Y 1 A PRO 19 ? A PRO 19 680 13 Y 1 A THR 20 ? A THR 20 681 13 Y 1 A PRO 21 ? A PRO 21 682 13 Y 1 A GLN 22 ? A GLN 22 683 13 Y 1 A ALA 23 ? A ALA 23 684 13 Y 1 A MSE 46 ? A MSE 46 685 13 Y 1 A MSE 47 ? A MSE 47 686 13 Y 1 A SER 48 ? A SER 48 687 13 Y 1 A LEU 49 ? A LEU 49 688 13 Y 1 A THR 50 ? A THR 50 689 13 Y 1 A LYS 94 ? A LYS 94 690 13 Y 1 A MSE 95 ? A MSE 95 691 13 Y 1 A VAL 96 ? A VAL 96 692 13 Y 1 A SER 97 ? A SER 97 693 13 Y 1 A MSE 98 ? A MSE 98 694 13 Y 1 A HIS 99 ? A HIS 99 695 13 Y 1 A SER 122 ? A SER 122 696 13 Y 1 A SER 123 ? A SER 123 697 13 Y 1 A MSE 124 ? A MSE 124 698 13 Y 1 A LEU 125 ? A LEU 125 699 13 Y 1 A GLN 126 ? A GLN 126 700 13 Y 1 A LEU 127 ? A LEU 127 701 13 Y 1 A LYS 128 ? A LYS 128 702 13 Y 1 A GLU 141 ? A GLU 141 703 13 Y 1 A HIS 175 ? A HIS 175 704 13 Y 1 A THR 176 ? A THR 176 705 13 Y 1 A VAL 177 ? A VAL 177 706 13 Y 1 A GLN 178 ? A GLN 178 707 13 Y 1 A SER 179 ? A SER 179 708 13 Y 1 A VAL 180 ? A VAL 180 709 13 Y 1 A PHE 181 ? A PHE 181 710 13 Y 1 A LEU 182 ? A LEU 182 711 13 Y 1 A GLU 213 ? A GLU 213 712 13 Y 1 A ASP 214 ? A ASP 214 713 13 Y 1 A ARG 215 ? A ARG 215 714 13 Y 1 A ALA 216 ? A ALA 216 715 13 Y 1 A ALA 217 ? A ALA 217 716 14 Y 1 A MSE 1 ? A MSE 1 717 14 Y 1 A GLU 2 ? A GLU 2 718 14 Y 1 A GLN 3 ? A GLN 3 719 14 Y 1 A PRO 4 ? A PRO 4 720 14 Y 1 A TYR 5 ? A TYR 5 721 14 Y 1 A VAL 6 ? A VAL 6 722 14 Y 1 A TYR 7 ? A TYR 7 723 14 Y 1 A ALA 8 ? A ALA 8 724 14 Y 1 A TYR 9 ? A TYR 9 725 14 Y 1 A PRO 10 ? A PRO 10 726 14 Y 1 A GLN 11 ? A GLN 11 727 14 Y 1 A GLY 12 ? A GLY 12 728 14 Y 1 A SER 13 ? A SER 13 729 14 Y 1 A GLY 14 ? A GLY 14 730 14 Y 1 A PRO 15 ? A PRO 15 731 14 Y 1 A SER 16 ? A SER 16 732 14 Y 1 A GLY 17 ? A GLY 17 733 14 Y 1 A ALA 18 ? A ALA 18 734 14 Y 1 A PRO 19 ? A PRO 19 735 14 Y 1 A THR 20 ? A THR 20 736 14 Y 1 A PRO 21 ? A PRO 21 737 14 Y 1 A GLN 22 ? A GLN 22 738 14 Y 1 A ALA 23 ? A ALA 23 739 14 Y 1 A MSE 46 ? A MSE 46 740 14 Y 1 A MSE 47 ? A MSE 47 741 14 Y 1 A SER 48 ? A SER 48 742 14 Y 1 A LEU 49 ? A LEU 49 743 14 Y 1 A THR 50 ? A THR 50 744 14 Y 1 A LYS 94 ? A LYS 94 745 14 Y 1 A MSE 95 ? A MSE 95 746 14 Y 1 A VAL 96 ? A VAL 96 747 14 Y 1 A SER 97 ? A SER 97 748 14 Y 1 A MSE 98 ? A MSE 98 749 14 Y 1 A HIS 99 ? A HIS 99 750 14 Y 1 A SER 122 ? A SER 122 751 14 Y 1 A SER 123 ? A SER 123 752 14 Y 1 A MSE 124 ? A MSE 124 753 14 Y 1 A LEU 125 ? A LEU 125 754 14 Y 1 A GLN 126 ? A GLN 126 755 14 Y 1 A LEU 127 ? A LEU 127 756 14 Y 1 A LYS 128 ? A LYS 128 757 14 Y 1 A GLU 141 ? A GLU 141 758 14 Y 1 A HIS 175 ? A HIS 175 759 14 Y 1 A THR 176 ? A THR 176 760 14 Y 1 A VAL 177 ? A VAL 177 761 14 Y 1 A GLN 178 ? A GLN 178 762 14 Y 1 A SER 179 ? A SER 179 763 14 Y 1 A VAL 180 ? A VAL 180 764 14 Y 1 A PHE 181 ? A PHE 181 765 14 Y 1 A LEU 182 ? A LEU 182 766 14 Y 1 A GLU 213 ? A GLU 213 767 14 Y 1 A ASP 214 ? A ASP 214 768 14 Y 1 A ARG 215 ? A ARG 215 769 14 Y 1 A ALA 216 ? A ALA 216 770 14 Y 1 A ALA 217 ? A ALA 217 771 15 Y 1 A MSE 1 ? A MSE 1 772 15 Y 1 A GLU 2 ? A GLU 2 773 15 Y 1 A GLN 3 ? A GLN 3 774 15 Y 1 A PRO 4 ? A PRO 4 775 15 Y 1 A TYR 5 ? A TYR 5 776 15 Y 1 A VAL 6 ? A VAL 6 777 15 Y 1 A TYR 7 ? A TYR 7 778 15 Y 1 A ALA 8 ? A ALA 8 779 15 Y 1 A TYR 9 ? A TYR 9 780 15 Y 1 A PRO 10 ? A PRO 10 781 15 Y 1 A GLN 11 ? A GLN 11 782 15 Y 1 A GLY 12 ? A GLY 12 783 15 Y 1 A SER 13 ? A SER 13 784 15 Y 1 A GLY 14 ? A GLY 14 785 15 Y 1 A PRO 15 ? A PRO 15 786 15 Y 1 A SER 16 ? A SER 16 787 15 Y 1 A GLY 17 ? A GLY 17 788 15 Y 1 A ALA 18 ? A ALA 18 789 15 Y 1 A PRO 19 ? A PRO 19 790 15 Y 1 A THR 20 ? A THR 20 791 15 Y 1 A PRO 21 ? A PRO 21 792 15 Y 1 A GLN 22 ? A GLN 22 793 15 Y 1 A ALA 23 ? A ALA 23 794 15 Y 1 A MSE 46 ? A MSE 46 795 15 Y 1 A MSE 47 ? A MSE 47 796 15 Y 1 A SER 48 ? A SER 48 797 15 Y 1 A LEU 49 ? A LEU 49 798 15 Y 1 A THR 50 ? A THR 50 799 15 Y 1 A LYS 94 ? A LYS 94 800 15 Y 1 A MSE 95 ? A MSE 95 801 15 Y 1 A VAL 96 ? A VAL 96 802 15 Y 1 A SER 97 ? A SER 97 803 15 Y 1 A MSE 98 ? A MSE 98 804 15 Y 1 A HIS 99 ? A HIS 99 805 15 Y 1 A SER 122 ? A SER 122 806 15 Y 1 A SER 123 ? A SER 123 807 15 Y 1 A MSE 124 ? A MSE 124 808 15 Y 1 A LEU 125 ? A LEU 125 809 15 Y 1 A GLN 126 ? A GLN 126 810 15 Y 1 A LEU 127 ? A LEU 127 811 15 Y 1 A LYS 128 ? A LYS 128 812 15 Y 1 A GLU 141 ? A GLU 141 813 15 Y 1 A HIS 175 ? A HIS 175 814 15 Y 1 A THR 176 ? A THR 176 815 15 Y 1 A VAL 177 ? A VAL 177 816 15 Y 1 A GLN 178 ? A GLN 178 817 15 Y 1 A SER 179 ? A SER 179 818 15 Y 1 A VAL 180 ? A VAL 180 819 15 Y 1 A PHE 181 ? A PHE 181 820 15 Y 1 A LEU 182 ? A LEU 182 821 15 Y 1 A GLU 213 ? A GLU 213 822 15 Y 1 A ASP 214 ? A ASP 214 823 15 Y 1 A ARG 215 ? A ARG 215 824 15 Y 1 A ALA 216 ? A ALA 216 825 15 Y 1 A ALA 217 ? A ALA 217 826 16 Y 1 A MSE 1 ? A MSE 1 827 16 Y 1 A GLU 2 ? A GLU 2 828 16 Y 1 A GLN 3 ? A GLN 3 829 16 Y 1 A PRO 4 ? A PRO 4 830 16 Y 1 A TYR 5 ? A TYR 5 831 16 Y 1 A VAL 6 ? A VAL 6 832 16 Y 1 A TYR 7 ? A TYR 7 833 16 Y 1 A ALA 8 ? A ALA 8 834 16 Y 1 A TYR 9 ? A TYR 9 835 16 Y 1 A PRO 10 ? A PRO 10 836 16 Y 1 A GLN 11 ? A GLN 11 837 16 Y 1 A GLY 12 ? A GLY 12 838 16 Y 1 A SER 13 ? A SER 13 839 16 Y 1 A GLY 14 ? A GLY 14 840 16 Y 1 A PRO 15 ? A PRO 15 841 16 Y 1 A SER 16 ? A SER 16 842 16 Y 1 A GLY 17 ? A GLY 17 843 16 Y 1 A ALA 18 ? A ALA 18 844 16 Y 1 A PRO 19 ? A PRO 19 845 16 Y 1 A THR 20 ? A THR 20 846 16 Y 1 A PRO 21 ? A PRO 21 847 16 Y 1 A GLN 22 ? A GLN 22 848 16 Y 1 A ALA 23 ? A ALA 23 849 16 Y 1 A MSE 46 ? A MSE 46 850 16 Y 1 A MSE 47 ? A MSE 47 851 16 Y 1 A SER 48 ? A SER 48 852 16 Y 1 A LEU 49 ? A LEU 49 853 16 Y 1 A THR 50 ? A THR 50 854 16 Y 1 A LYS 94 ? A LYS 94 855 16 Y 1 A MSE 95 ? A MSE 95 856 16 Y 1 A VAL 96 ? A VAL 96 857 16 Y 1 A SER 97 ? A SER 97 858 16 Y 1 A MSE 98 ? A MSE 98 859 16 Y 1 A HIS 99 ? A HIS 99 860 16 Y 1 A SER 122 ? A SER 122 861 16 Y 1 A SER 123 ? A SER 123 862 16 Y 1 A MSE 124 ? A MSE 124 863 16 Y 1 A LEU 125 ? A LEU 125 864 16 Y 1 A GLN 126 ? A GLN 126 865 16 Y 1 A LEU 127 ? A LEU 127 866 16 Y 1 A LYS 128 ? A LYS 128 867 16 Y 1 A GLU 141 ? A GLU 141 868 16 Y 1 A HIS 175 ? A HIS 175 869 16 Y 1 A THR 176 ? A THR 176 870 16 Y 1 A VAL 177 ? A VAL 177 871 16 Y 1 A GLN 178 ? A GLN 178 872 16 Y 1 A SER 179 ? A SER 179 873 16 Y 1 A VAL 180 ? A VAL 180 874 16 Y 1 A PHE 181 ? A PHE 181 875 16 Y 1 A LEU 182 ? A LEU 182 876 16 Y 1 A GLU 213 ? A GLU 213 877 16 Y 1 A ASP 214 ? A ASP 214 878 16 Y 1 A ARG 215 ? A ARG 215 879 16 Y 1 A ALA 216 ? A ALA 216 880 16 Y 1 A ALA 217 ? A ALA 217 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 MSE N N N N 260 MSE CA C N S 261 MSE C C N N 262 MSE O O N N 263 MSE OXT O N N 264 MSE CB C N N 265 MSE CG C N N 266 MSE SE SE N N 267 MSE CE C N N 268 MSE H H N N 269 MSE H2 H N N 270 MSE HA H N N 271 MSE HXT H N N 272 MSE HB2 H N N 273 MSE HB3 H N N 274 MSE HG2 H N N 275 MSE HG3 H N N 276 MSE HE1 H N N 277 MSE HE2 H N N 278 MSE HE3 H N N 279 PHE N N N N 280 PHE CA C N S 281 PHE C C N N 282 PHE O O N N 283 PHE CB C N N 284 PHE CG C Y N 285 PHE CD1 C Y N 286 PHE CD2 C Y N 287 PHE CE1 C Y N 288 PHE CE2 C Y N 289 PHE CZ C Y N 290 PHE OXT O N N 291 PHE H H N N 292 PHE H2 H N N 293 PHE HA H N N 294 PHE HB2 H N N 295 PHE HB3 H N N 296 PHE HD1 H N N 297 PHE HD2 H N N 298 PHE HE1 H N N 299 PHE HE2 H N N 300 PHE HZ H N N 301 PHE HXT H N N 302 PRO N N N N 303 PRO CA C N S 304 PRO C C N N 305 PRO O O N N 306 PRO CB C N N 307 PRO CG C N N 308 PRO CD C N N 309 PRO OXT O N N 310 PRO H H N N 311 PRO HA H N N 312 PRO HB2 H N N 313 PRO HB3 H N N 314 PRO HG2 H N N 315 PRO HG3 H N N 316 PRO HD2 H N N 317 PRO HD3 H N N 318 PRO HXT H N N 319 SER N N N N 320 SER CA C N S 321 SER C C N N 322 SER O O N N 323 SER CB C N N 324 SER OG O N N 325 SER OXT O N N 326 SER H H N N 327 SER H2 H N N 328 SER HA H N N 329 SER HB2 H N N 330 SER HB3 H N N 331 SER HG H N N 332 SER HXT H N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 MSE N CA sing N N 246 MSE N H sing N N 247 MSE N H2 sing N N 248 MSE CA C sing N N 249 MSE CA CB sing N N 250 MSE CA HA sing N N 251 MSE C O doub N N 252 MSE C OXT sing N N 253 MSE OXT HXT sing N N 254 MSE CB CG sing N N 255 MSE CB HB2 sing N N 256 MSE CB HB3 sing N N 257 MSE CG SE sing N N 258 MSE CG HG2 sing N N 259 MSE CG HG3 sing N N 260 MSE SE CE sing N N 261 MSE CE HE1 sing N N 262 MSE CE HE2 sing N N 263 MSE CE HE3 sing N N 264 PHE N CA sing N N 265 PHE N H sing N N 266 PHE N H2 sing N N 267 PHE CA C sing N N 268 PHE CA CB sing N N 269 PHE CA HA sing N N 270 PHE C O doub N N 271 PHE C OXT sing N N 272 PHE CB CG sing N N 273 PHE CB HB2 sing N N 274 PHE CB HB3 sing N N 275 PHE CG CD1 doub Y N 276 PHE CG CD2 sing Y N 277 PHE CD1 CE1 sing Y N 278 PHE CD1 HD1 sing N N 279 PHE CD2 CE2 doub Y N 280 PHE CD2 HD2 sing N N 281 PHE CE1 CZ doub Y N 282 PHE CE1 HE1 sing N N 283 PHE CE2 CZ sing Y N 284 PHE CE2 HE2 sing N N 285 PHE CZ HZ sing N N 286 PHE OXT HXT sing N N 287 PRO N CA sing N N 288 PRO N CD sing N N 289 PRO N H sing N N 290 PRO CA C sing N N 291 PRO CA CB sing N N 292 PRO CA HA sing N N 293 PRO C O doub N N 294 PRO C OXT sing N N 295 PRO CB CG sing N N 296 PRO CB HB2 sing N N 297 PRO CB HB3 sing N N 298 PRO CG CD sing N N 299 PRO CG HG2 sing N N 300 PRO CG HG3 sing N N 301 PRO CD HD2 sing N N 302 PRO CD HD3 sing N N 303 PRO OXT HXT sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 THR N CA sing N N 318 THR N H sing N N 319 THR N H2 sing N N 320 THR CA C sing N N 321 THR CA CB sing N N 322 THR CA HA sing N N 323 THR C O doub N N 324 THR C OXT sing N N 325 THR CB OG1 sing N N 326 THR CB CG2 sing N N 327 THR CB HB sing N N 328 THR OG1 HG1 sing N N 329 THR CG2 HG21 sing N N 330 THR CG2 HG22 sing N N 331 THR CG2 HG23 sing N N 332 THR OXT HXT sing N N 333 TRP N CA sing N N 334 TRP N H sing N N 335 TRP N H2 sing N N 336 TRP CA C sing N N 337 TRP CA CB sing N N 338 TRP CA HA sing N N 339 TRP C O doub N N 340 TRP C OXT sing N N 341 TRP CB CG sing N N 342 TRP CB HB2 sing N N 343 TRP CB HB3 sing N N 344 TRP CG CD1 doub Y N 345 TRP CG CD2 sing Y N 346 TRP CD1 NE1 sing Y N 347 TRP CD1 HD1 sing N N 348 TRP CD2 CE2 doub Y N 349 TRP CD2 CE3 sing Y N 350 TRP NE1 CE2 sing Y N 351 TRP NE1 HE1 sing N N 352 TRP CE2 CZ2 sing Y N 353 TRP CE3 CZ3 doub Y N 354 TRP CE3 HE3 sing N N 355 TRP CZ2 CH2 doub Y N 356 TRP CZ2 HZ2 sing N N 357 TRP CZ3 CH2 sing Y N 358 TRP CZ3 HZ3 sing N N 359 TRP CH2 HH2 sing N N 360 TRP OXT HXT sing N N 361 TYR N CA sing N N 362 TYR N H sing N N 363 TYR N H2 sing N N 364 TYR CA C sing N N 365 TYR CA CB sing N N 366 TYR CA HA sing N N 367 TYR C O doub N N 368 TYR C OXT sing N N 369 TYR CB CG sing N N 370 TYR CB HB2 sing N N 371 TYR CB HB3 sing N N 372 TYR CG CD1 doub Y N 373 TYR CG CD2 sing Y N 374 TYR CD1 CE1 sing Y N 375 TYR CD1 HD1 sing N N 376 TYR CD2 CE2 doub Y N 377 TYR CD2 HD2 sing N N 378 TYR CE1 CZ doub Y N 379 TYR CE1 HE1 sing N N 380 TYR CE2 CZ sing Y N 381 TYR CE2 HE2 sing N N 382 TYR CZ OH sing N N 383 TYR OH HH sing N N 384 TYR OXT HXT sing N N 385 VAL N CA sing N N 386 VAL N H sing N N 387 VAL N H2 sing N N 388 VAL CA C sing N N 389 VAL CA CB sing N N 390 VAL CA HA sing N N 391 VAL C O doub N N 392 VAL C OXT sing N N 393 VAL CB CG1 sing N N 394 VAL CB CG2 sing N N 395 VAL CB HB sing N N 396 VAL CG1 HG11 sing N N 397 VAL CG1 HG12 sing N N 398 VAL CG1 HG13 sing N N 399 VAL CG2 HG21 sing N N 400 VAL CG2 HG22 sing N N 401 VAL CG2 HG23 sing N N 402 VAL OXT HXT sing N N 403 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ZXU _pdbx_initial_refinement_model.details 'PDB entry 1ZXU' # _atom_sites.entry_id 2Q4M _atom_sites.fract_transf_matrix[1][1] 0.024351 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017392 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013270 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_