data_2Q8V # _entry.id 2Q8V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2Q8V pdb_00002q8v 10.2210/pdb2q8v/pdb RCSB RCSB043295 ? ? WWPDB D_1000043295 ? ? # _pdbx_database_status.entry_id 2Q8V _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-12 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Adir, N.' 1 'Dines, M.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome ; J.Biol.Chem. 283 30330 30340 2008 JBCHA3 US 0021-9258 0071 ? 18718907 10.1074/jbc.M804241200 1 'Crystallization of sparingly soluble stress-related proteins from cyanobacteria by controlled urea solublization' J.Struct.Biol. 158 116 121 2007 JSBIEM US 1047-8477 0803 ? 17187990 10.1016/j.jsb.2006.10.021 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dines, M.' 1 ? primary 'Sendersky, E.' 2 ? primary 'David, L.' 3 ? primary 'Schwarz, R.' 4 ? primary 'Adir, N.' 5 ? 1 'Dines, M.' 6 ? 1 'Sendersky, E.' 7 ? 1 'Schwarz, R.' 8 ? 1 'Adir, N.' 9 ? # _cell.entry_id 2Q8V _cell.length_a 43.265 _cell.length_b 43.265 _cell.length_c 149.400 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2Q8V _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NblA protein' 7467.691 2 ? ? ? ? 2 non-polymer syn UREA 60.055 2 ? ? ? ? 3 water nat water 18.015 16 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MEQRFPELNVDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAARS _entity_poly.pdbx_seq_one_letter_code_can MEQRFPELNVDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAARS _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLN n 1 4 ARG n 1 5 PHE n 1 6 PRO n 1 7 GLU n 1 8 LEU n 1 9 ASN n 1 10 VAL n 1 11 ASP n 1 12 LEU n 1 13 SER n 1 14 PHE n 1 15 GLU n 1 16 GLN n 1 17 GLU n 1 18 PHE n 1 19 GLN n 1 20 MET n 1 21 ARG n 1 22 VAL n 1 23 MET n 1 24 GLU n 1 25 GLU n 1 26 GLN n 1 27 VAL n 1 28 SER n 1 29 ALA n 1 30 MET n 1 31 SER n 1 32 LEU n 1 33 GLN n 1 34 GLU n 1 35 ALA n 1 36 ARG n 1 37 GLU n 1 38 LEU n 1 39 LEU n 1 40 LEU n 1 41 GLN n 1 42 ALA n 1 43 SER n 1 44 ARG n 1 45 LEU n 1 46 LEU n 1 47 MET n 1 48 MET n 1 49 LYS n 1 50 ASP n 1 51 ASN n 1 52 VAL n 1 53 ILE n 1 54 ARG n 1 55 SER n 1 56 LEU n 1 57 VAL n 1 58 LYS n 1 59 ARG n 1 60 ALA n 1 61 ALA n 1 62 ARG n 1 63 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cyanobacteria _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene nblA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermosynechococcus vulcanus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32053 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE60 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2Q8V _struct_ref.pdbx_db_accession 2Q8V _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2Q8V A 1 ? 63 ? 2Q8V 1 ? 63 ? 1 63 2 1 2Q8V B 1 ? 63 ? 2Q8V 1 ? 63 ? 1 63 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 URE non-polymer . UREA ? 'C H4 N2 O' 60.055 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2Q8V _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.70 _exptl_crystal.density_percent_sol 54.49 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pdbx_details '25% elthelene glycol, 2M Urea, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M ? 'SINGLE WAVELENGTH' x-ray 2 1 M ? 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97913 1.0 2 0.9792 1.0 # loop_ _diffrn_source.diffrn_id _diffrn_source.source _diffrn_source.type _diffrn_source.pdbx_synchrotron_site _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_wavelength_list 1 SYNCHROTRON 'ESRF BEAMLINE BM30A' ESRF BM30A ? 0.97913 2 SYNCHROTRON 'ESRF BEAMLINE ID14-1' ESRF ID14-1 ? 0.9792 # _reflns.entry_id 2Q8V _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I 2.5 _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50. _reflns.number_all ? _reflns.number_obs 6108 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.073 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 19.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1,2 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.64 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.326 _reflns_shell.pdbx_Rsym_value 0.358 _reflns_shell.meanI_over_sigI_obs 4.4 _reflns_shell.pdbx_redundancy 5.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 849 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2Q8V _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 30 _refine.pdbx_ls_sigma_F 0. _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6108 _refine.ls_number_reflns_R_free 984 _refine.ls_percent_reflns_obs 100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.245 _refine.ls_R_factor_R_free 0.264 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'SAD/Molecular Replacement' _refine.pdbx_starting_model 1OJH _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model Isotropic _refine.B_iso_mean 36.4 _refine.aniso_B[1][1] -6.085 _refine.aniso_B[1][2] -7.701 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -6.085 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 12.170 _refine.details ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2Q8V _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_sigma_a_obs 0.27 _refine_analyze.Luzzati_d_res_low_obs 5 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.19 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 843 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 867 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 30 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_angle_deg 1.09 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d 0.0096 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.72 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2Q8V _struct.title 'NblA protein from T. vulcanus crystallized with urea' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Q8V _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Phycobilisome; nutrient starvation; disassembly; bleaching, PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 15 ? ALA A 29 ? GLU A 15 ALA A 29 1 ? 15 HELX_P HELX_P2 2 SER A 31 ? ARG A 59 ? SER A 31 ARG A 59 1 ? 29 HELX_P HELX_P3 3 GLU B 17 ? SER B 28 ? GLU B 17 SER B 28 1 ? 12 HELX_P HELX_P4 4 SER B 31 ? ARG B 59 ? SER B 31 ARG B 59 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A URE 301 ? 5 'BINDING SITE FOR RESIDUE URE A 301' AC2 Software B URE 300 ? 1 'BINDING SITE FOR RESIDUE URE B 300' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 MET A 47 ? MET A 47 . ? 1_555 ? 2 AC1 5 ASN A 51 ? ASN A 51 . ? 1_555 ? 3 AC1 5 HOH E . ? HOH A 305 . ? 1_555 ? 4 AC1 5 SER B 13 ? SER B 13 . ? 1_555 ? 5 AC1 5 PHE B 14 ? PHE B 14 . ? 1_555 ? 6 AC2 1 GLN B 41 ? GLN B 41 . ? 1_555 ? # _atom_sites.entry_id 2Q8V _atom_sites.fract_transf_matrix[1][1] 0.023113 _atom_sites.fract_transf_matrix[1][2] 0.013345 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026689 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006693 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 GLN 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 PHE 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 ? ? ? A . n A 1 62 ARG 62 62 ? ? ? A . n A 1 63 SER 63 63 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 GLU 2 2 ? ? ? B . n B 1 3 GLN 3 3 ? ? ? B . n B 1 4 ARG 4 4 ? ? ? B . n B 1 5 PHE 5 5 ? ? ? B . n B 1 6 PRO 6 6 ? ? ? B . n B 1 7 GLU 7 7 ? ? ? B . n B 1 8 LEU 8 8 ? ? ? B . n B 1 9 ASN 9 9 ? ? ? B . n B 1 10 VAL 10 10 ? ? ? B . n B 1 11 ASP 11 11 ? ? ? B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 SER 13 13 13 SER SER B . n B 1 14 PHE 14 14 14 PHE PHE B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 GLN 16 16 16 GLN GLN B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 PHE 18 18 18 PHE PHE B . n B 1 19 GLN 19 19 19 GLN GLN B . n B 1 20 MET 20 20 20 MET MET B . n B 1 21 ARG 21 21 21 ARG ARG B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 MET 23 23 23 MET MET B . n B 1 24 GLU 24 24 24 GLU GLU B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 VAL 27 27 27 VAL VAL B . n B 1 28 SER 28 28 28 SER SER B . n B 1 29 ALA 29 29 29 ALA ALA B . n B 1 30 MET 30 30 30 MET MET B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 ALA 35 35 35 ALA ALA B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 LEU 40 40 40 LEU LEU B . n B 1 41 GLN 41 41 41 GLN GLN B . n B 1 42 ALA 42 42 42 ALA ALA B . n B 1 43 SER 43 43 43 SER SER B . n B 1 44 ARG 44 44 44 ARG ARG B . n B 1 45 LEU 45 45 45 LEU LEU B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 MET 47 47 47 MET MET B . n B 1 48 MET 48 48 48 MET MET B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 ASP 50 50 50 ASP ASP B . n B 1 51 ASN 51 51 51 ASN ASN B . n B 1 52 VAL 52 52 52 VAL VAL B . n B 1 53 ILE 53 53 53 ILE ILE B . n B 1 54 ARG 54 54 54 ARG ARG B . n B 1 55 SER 55 55 55 SER SER B . n B 1 56 LEU 56 56 56 LEU LEU B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 ARG 59 59 59 ARG ARG B . n B 1 60 ALA 60 60 60 ALA ALA B . n B 1 61 ALA 61 61 61 ALA ALA B . n B 1 62 ARG 62 62 62 ARG ALA B . n B 1 63 SER 63 63 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 URE 1 301 301 URE URE A . D 2 URE 1 300 300 URE URE B . E 3 HOH 1 302 2 HOH HOH A . E 3 HOH 2 303 5 HOH HOH A . E 3 HOH 3 304 6 HOH HOH A . E 3 HOH 4 305 8 HOH HOH A . E 3 HOH 5 306 10 HOH HOH A . E 3 HOH 6 307 11 HOH HOH A . E 3 HOH 7 308 13 HOH HOH A . E 3 HOH 8 309 17 HOH HOH A . E 3 HOH 9 310 18 HOH HOH A . F 3 HOH 1 301 3 HOH HOH B . F 3 HOH 2 302 4 HOH HOH B . F 3 HOH 3 303 7 HOH HOH B . F 3 HOH 4 304 9 HOH HOH B . F 3 HOH 5 305 12 HOH HOH B . F 3 HOH 6 306 15 HOH HOH B . F 3 HOH 7 307 16 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3810 ? 1 MORE -34 ? 1 'SSA (A^2)' 7520 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-07-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 4 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 5 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DNA 'data collection' . ? 1 CCP4 'model building' . ? 2 CNS refinement 1.1 ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 CCP4 phasing . ? 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 URE _pdbx_validate_close_contact.auth_seq_id_1 301 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 305 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.70 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 10 ? ? -132.84 -32.90 2 1 PHE A 14 ? ? 69.40 103.49 3 1 GLU A 15 ? ? 103.11 -43.72 4 1 ARG A 59 ? ? -69.58 56.08 5 1 GLN B 16 ? ? -52.03 25.48 6 1 ARG B 59 ? ? -59.31 47.94 7 1 ALA B 60 ? ? -95.71 58.79 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 PHE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 14 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 15 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -146.12 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 B ARG 62 ? CG ? B ARG 62 CG 2 1 Y 1 B ARG 62 ? CD ? B ARG 62 CD 3 1 Y 1 B ARG 62 ? NE ? B ARG 62 NE 4 1 Y 1 B ARG 62 ? CZ ? B ARG 62 CZ 5 1 Y 1 B ARG 62 ? NH1 ? B ARG 62 NH1 6 1 Y 1 B ARG 62 ? NH2 ? B ARG 62 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A GLN 3 ? A GLN 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A PHE 5 ? A PHE 5 6 1 Y 1 A PRO 6 ? A PRO 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A ALA 61 ? A ALA 61 9 1 Y 1 A ARG 62 ? A ARG 62 10 1 Y 1 A SER 63 ? A SER 63 11 1 Y 1 B MET 1 ? B MET 1 12 1 Y 1 B GLU 2 ? B GLU 2 13 1 Y 1 B GLN 3 ? B GLN 3 14 1 Y 1 B ARG 4 ? B ARG 4 15 1 Y 1 B PHE 5 ? B PHE 5 16 1 Y 1 B PRO 6 ? B PRO 6 17 1 Y 1 B GLU 7 ? B GLU 7 18 1 Y 1 B LEU 8 ? B LEU 8 19 1 Y 1 B ASN 9 ? B ASN 9 20 1 Y 1 B VAL 10 ? B VAL 10 21 1 Y 1 B ASP 11 ? B ASP 11 22 1 Y 1 B SER 63 ? B SER 63 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HOH O O N N 113 HOH H1 H N N 114 HOH H2 H N N 115 ILE N N N N 116 ILE CA C N S 117 ILE C C N N 118 ILE O O N N 119 ILE CB C N S 120 ILE CG1 C N N 121 ILE CG2 C N N 122 ILE CD1 C N N 123 ILE OXT O N N 124 ILE H H N N 125 ILE H2 H N N 126 ILE HA H N N 127 ILE HB H N N 128 ILE HG12 H N N 129 ILE HG13 H N N 130 ILE HG21 H N N 131 ILE HG22 H N N 132 ILE HG23 H N N 133 ILE HD11 H N N 134 ILE HD12 H N N 135 ILE HD13 H N N 136 ILE HXT H N N 137 LEU N N N N 138 LEU CA C N S 139 LEU C C N N 140 LEU O O N N 141 LEU CB C N N 142 LEU CG C N N 143 LEU CD1 C N N 144 LEU CD2 C N N 145 LEU OXT O N N 146 LEU H H N N 147 LEU H2 H N N 148 LEU HA H N N 149 LEU HB2 H N N 150 LEU HB3 H N N 151 LEU HG H N N 152 LEU HD11 H N N 153 LEU HD12 H N N 154 LEU HD13 H N N 155 LEU HD21 H N N 156 LEU HD22 H N N 157 LEU HD23 H N N 158 LEU HXT H N N 159 LYS N N N N 160 LYS CA C N S 161 LYS C C N N 162 LYS O O N N 163 LYS CB C N N 164 LYS CG C N N 165 LYS CD C N N 166 LYS CE C N N 167 LYS NZ N N N 168 LYS OXT O N N 169 LYS H H N N 170 LYS H2 H N N 171 LYS HA H N N 172 LYS HB2 H N N 173 LYS HB3 H N N 174 LYS HG2 H N N 175 LYS HG3 H N N 176 LYS HD2 H N N 177 LYS HD3 H N N 178 LYS HE2 H N N 179 LYS HE3 H N N 180 LYS HZ1 H N N 181 LYS HZ2 H N N 182 LYS HZ3 H N N 183 LYS HXT H N N 184 MET N N N N 185 MET CA C N S 186 MET C C N N 187 MET O O N N 188 MET CB C N N 189 MET CG C N N 190 MET SD S N N 191 MET CE C N N 192 MET OXT O N N 193 MET H H N N 194 MET H2 H N N 195 MET HA H N N 196 MET HB2 H N N 197 MET HB3 H N N 198 MET HG2 H N N 199 MET HG3 H N N 200 MET HE1 H N N 201 MET HE2 H N N 202 MET HE3 H N N 203 MET HXT H N N 204 PHE N N N N 205 PHE CA C N S 206 PHE C C N N 207 PHE O O N N 208 PHE CB C N N 209 PHE CG C Y N 210 PHE CD1 C Y N 211 PHE CD2 C Y N 212 PHE CE1 C Y N 213 PHE CE2 C Y N 214 PHE CZ C Y N 215 PHE OXT O N N 216 PHE H H N N 217 PHE H2 H N N 218 PHE HA H N N 219 PHE HB2 H N N 220 PHE HB3 H N N 221 PHE HD1 H N N 222 PHE HD2 H N N 223 PHE HE1 H N N 224 PHE HE2 H N N 225 PHE HZ H N N 226 PHE HXT H N N 227 PRO N N N N 228 PRO CA C N S 229 PRO C C N N 230 PRO O O N N 231 PRO CB C N N 232 PRO CG C N N 233 PRO CD C N N 234 PRO OXT O N N 235 PRO H H N N 236 PRO HA H N N 237 PRO HB2 H N N 238 PRO HB3 H N N 239 PRO HG2 H N N 240 PRO HG3 H N N 241 PRO HD2 H N N 242 PRO HD3 H N N 243 PRO HXT H N N 244 SER N N N N 245 SER CA C N S 246 SER C C N N 247 SER O O N N 248 SER CB C N N 249 SER OG O N N 250 SER OXT O N N 251 SER H H N N 252 SER H2 H N N 253 SER HA H N N 254 SER HB2 H N N 255 SER HB3 H N N 256 SER HG H N N 257 SER HXT H N N 258 URE C C N N 259 URE O O N N 260 URE N1 N N N 261 URE N2 N N N 262 URE HN11 H N N 263 URE HN12 H N N 264 URE HN21 H N N 265 URE HN22 H N N 266 VAL N N N N 267 VAL CA C N S 268 VAL C C N N 269 VAL O O N N 270 VAL CB C N N 271 VAL CG1 C N N 272 VAL CG2 C N N 273 VAL OXT O N N 274 VAL H H N N 275 VAL H2 H N N 276 VAL HA H N N 277 VAL HB H N N 278 VAL HG11 H N N 279 VAL HG12 H N N 280 VAL HG13 H N N 281 VAL HG21 H N N 282 VAL HG22 H N N 283 VAL HG23 H N N 284 VAL HXT H N N 285 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HOH O H1 sing N N 107 HOH O H2 sing N N 108 ILE N CA sing N N 109 ILE N H sing N N 110 ILE N H2 sing N N 111 ILE CA C sing N N 112 ILE CA CB sing N N 113 ILE CA HA sing N N 114 ILE C O doub N N 115 ILE C OXT sing N N 116 ILE CB CG1 sing N N 117 ILE CB CG2 sing N N 118 ILE CB HB sing N N 119 ILE CG1 CD1 sing N N 120 ILE CG1 HG12 sing N N 121 ILE CG1 HG13 sing N N 122 ILE CG2 HG21 sing N N 123 ILE CG2 HG22 sing N N 124 ILE CG2 HG23 sing N N 125 ILE CD1 HD11 sing N N 126 ILE CD1 HD12 sing N N 127 ILE CD1 HD13 sing N N 128 ILE OXT HXT sing N N 129 LEU N CA sing N N 130 LEU N H sing N N 131 LEU N H2 sing N N 132 LEU CA C sing N N 133 LEU CA CB sing N N 134 LEU CA HA sing N N 135 LEU C O doub N N 136 LEU C OXT sing N N 137 LEU CB CG sing N N 138 LEU CB HB2 sing N N 139 LEU CB HB3 sing N N 140 LEU CG CD1 sing N N 141 LEU CG CD2 sing N N 142 LEU CG HG sing N N 143 LEU CD1 HD11 sing N N 144 LEU CD1 HD12 sing N N 145 LEU CD1 HD13 sing N N 146 LEU CD2 HD21 sing N N 147 LEU CD2 HD22 sing N N 148 LEU CD2 HD23 sing N N 149 LEU OXT HXT sing N N 150 LYS N CA sing N N 151 LYS N H sing N N 152 LYS N H2 sing N N 153 LYS CA C sing N N 154 LYS CA CB sing N N 155 LYS CA HA sing N N 156 LYS C O doub N N 157 LYS C OXT sing N N 158 LYS CB CG sing N N 159 LYS CB HB2 sing N N 160 LYS CB HB3 sing N N 161 LYS CG CD sing N N 162 LYS CG HG2 sing N N 163 LYS CG HG3 sing N N 164 LYS CD CE sing N N 165 LYS CD HD2 sing N N 166 LYS CD HD3 sing N N 167 LYS CE NZ sing N N 168 LYS CE HE2 sing N N 169 LYS CE HE3 sing N N 170 LYS NZ HZ1 sing N N 171 LYS NZ HZ2 sing N N 172 LYS NZ HZ3 sing N N 173 LYS OXT HXT sing N N 174 MET N CA sing N N 175 MET N H sing N N 176 MET N H2 sing N N 177 MET CA C sing N N 178 MET CA CB sing N N 179 MET CA HA sing N N 180 MET C O doub N N 181 MET C OXT sing N N 182 MET CB CG sing N N 183 MET CB HB2 sing N N 184 MET CB HB3 sing N N 185 MET CG SD sing N N 186 MET CG HG2 sing N N 187 MET CG HG3 sing N N 188 MET SD CE sing N N 189 MET CE HE1 sing N N 190 MET CE HE2 sing N N 191 MET CE HE3 sing N N 192 MET OXT HXT sing N N 193 PHE N CA sing N N 194 PHE N H sing N N 195 PHE N H2 sing N N 196 PHE CA C sing N N 197 PHE CA CB sing N N 198 PHE CA HA sing N N 199 PHE C O doub N N 200 PHE C OXT sing N N 201 PHE CB CG sing N N 202 PHE CB HB2 sing N N 203 PHE CB HB3 sing N N 204 PHE CG CD1 doub Y N 205 PHE CG CD2 sing Y N 206 PHE CD1 CE1 sing Y N 207 PHE CD1 HD1 sing N N 208 PHE CD2 CE2 doub Y N 209 PHE CD2 HD2 sing N N 210 PHE CE1 CZ doub Y N 211 PHE CE1 HE1 sing N N 212 PHE CE2 CZ sing Y N 213 PHE CE2 HE2 sing N N 214 PHE CZ HZ sing N N 215 PHE OXT HXT sing N N 216 PRO N CA sing N N 217 PRO N CD sing N N 218 PRO N H sing N N 219 PRO CA C sing N N 220 PRO CA CB sing N N 221 PRO CA HA sing N N 222 PRO C O doub N N 223 PRO C OXT sing N N 224 PRO CB CG sing N N 225 PRO CB HB2 sing N N 226 PRO CB HB3 sing N N 227 PRO CG CD sing N N 228 PRO CG HG2 sing N N 229 PRO CG HG3 sing N N 230 PRO CD HD2 sing N N 231 PRO CD HD3 sing N N 232 PRO OXT HXT sing N N 233 SER N CA sing N N 234 SER N H sing N N 235 SER N H2 sing N N 236 SER CA C sing N N 237 SER CA CB sing N N 238 SER CA HA sing N N 239 SER C O doub N N 240 SER C OXT sing N N 241 SER CB OG sing N N 242 SER CB HB2 sing N N 243 SER CB HB3 sing N N 244 SER OG HG sing N N 245 SER OXT HXT sing N N 246 URE C O doub N N 247 URE C N1 sing N N 248 URE C N2 sing N N 249 URE N1 HN11 sing N N 250 URE N1 HN12 sing N N 251 URE N2 HN21 sing N N 252 URE N2 HN22 sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 UREA URE 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1OJH _pdbx_initial_refinement_model.details ? #