data_2QSW # _entry.id 2QSW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2QSW pdb_00002qsw 10.2210/pdb2qsw/pdb RCSB RCSB044013 ? ? WWPDB D_1000044013 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_conn_type 9 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 3 'Structure model' '_pdbx_struct_conn_angle.value' 20 3 'Structure model' '_struct_conn.conn_type_id' 21 3 'Structure model' '_struct_conn.id' 22 3 'Structure model' '_struct_conn.pdbx_dist_value' 23 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 24 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 3 'Structure model' '_struct_conn.ptnr1_symmetry' 31 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 37 3 'Structure model' '_struct_conn.ptnr2_symmetry' 38 3 'Structure model' '_struct_conn_type.id' 39 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2QSW _pdbx_database_status.recvd_initial_deposition_date 2007-07-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC87322.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Osipiuk, J.' 1 'Bigelow, L.' 2 'Clancy, S.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'X-ray structure of C-terminal domain of ABC transporter / ATP-binding protein from Enterococcus faecalis.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Osipiuk, J.' 1 ? primary 'Bigelow, L.' 2 ? primary 'Clancy, S.' 3 ? primary 'Joachimiak, A.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methionine import ATP-binding protein metN 2' 11281.647 1 3.6.3.- ? 'C-terminal domain: Residues 249-345' ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 102 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNAKNIEETELVVEE(MSE)LEQYPNGKIVRLLFHGEQAKLPIISHIVQEYQVEVSIIQGNIQQTKQGAVGSLYIQLLGE EQNILAAIEGLRKLRVETEVIGNE ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAKNIEETELVVEEMLEQYPNGKIVRLLFHGEQAKLPIISHIVQEYQVEVSIIQGNIQQTKQGAVGSLYIQLLGEEQNI LAAIEGLRKLRVETEVIGNE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC87322.1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 LYS n 1 5 ASN n 1 6 ILE n 1 7 GLU n 1 8 GLU n 1 9 THR n 1 10 GLU n 1 11 LEU n 1 12 VAL n 1 13 VAL n 1 14 GLU n 1 15 GLU n 1 16 MSE n 1 17 LEU n 1 18 GLU n 1 19 GLN n 1 20 TYR n 1 21 PRO n 1 22 ASN n 1 23 GLY n 1 24 LYS n 1 25 ILE n 1 26 VAL n 1 27 ARG n 1 28 LEU n 1 29 LEU n 1 30 PHE n 1 31 HIS n 1 32 GLY n 1 33 GLU n 1 34 GLN n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 PRO n 1 39 ILE n 1 40 ILE n 1 41 SER n 1 42 HIS n 1 43 ILE n 1 44 VAL n 1 45 GLN n 1 46 GLU n 1 47 TYR n 1 48 GLN n 1 49 VAL n 1 50 GLU n 1 51 VAL n 1 52 SER n 1 53 ILE n 1 54 ILE n 1 55 GLN n 1 56 GLY n 1 57 ASN n 1 58 ILE n 1 59 GLN n 1 60 GLN n 1 61 THR n 1 62 LYS n 1 63 GLN n 1 64 GLY n 1 65 ALA n 1 66 VAL n 1 67 GLY n 1 68 SER n 1 69 LEU n 1 70 TYR n 1 71 ILE n 1 72 GLN n 1 73 LEU n 1 74 LEU n 1 75 GLY n 1 76 GLU n 1 77 GLU n 1 78 GLN n 1 79 ASN n 1 80 ILE n 1 81 LEU n 1 82 ALA n 1 83 ALA n 1 84 ILE n 1 85 GLU n 1 86 GLY n 1 87 LEU n 1 88 ARG n 1 89 LYS n 1 90 LEU n 1 91 ARG n 1 92 VAL n 1 93 GLU n 1 94 THR n 1 95 GLU n 1 96 VAL n 1 97 ILE n 1 98 GLY n 1 99 ASN n 1 100 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Enterococcus _entity_src_gen.pdbx_gene_src_gene 'metN2, EF_2498' _entity_src_gen.gene_src_species 'Enterococcus faecalis' _entity_src_gen.gene_src_strain V583 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus faecalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226185 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700802 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 246 ? ? ? A . n A 1 2 ASN 2 247 ? ? ? A . n A 1 3 ALA 3 248 ? ? ? A . n A 1 4 LYS 4 249 ? ? ? A . n A 1 5 ASN 5 250 ? ? ? A . n A 1 6 ILE 6 251 ? ? ? A . n A 1 7 GLU 7 252 ? ? ? A . n A 1 8 GLU 8 253 ? ? ? A . n A 1 9 THR 9 254 ? ? ? A . n A 1 10 GLU 10 255 ? ? ? A . n A 1 11 LEU 11 256 256 LEU LEU A . n A 1 12 VAL 12 257 257 VAL VAL A . n A 1 13 VAL 13 258 258 VAL VAL A . n A 1 14 GLU 14 259 259 GLU GLU A . n A 1 15 GLU 15 260 260 GLU GLU A . n A 1 16 MSE 16 261 261 MSE MSE A . n A 1 17 LEU 17 262 262 LEU LEU A . n A 1 18 GLU 18 263 263 GLU GLU A . n A 1 19 GLN 19 264 264 GLN GLN A . n A 1 20 TYR 20 265 265 TYR TYR A . n A 1 21 PRO 21 266 266 PRO PRO A . n A 1 22 ASN 22 267 267 ASN ASN A . n A 1 23 GLY 23 268 268 GLY GLY A . n A 1 24 LYS 24 269 269 LYS LYS A . n A 1 25 ILE 25 270 270 ILE ILE A . n A 1 26 VAL 26 271 271 VAL VAL A . n A 1 27 ARG 27 272 272 ARG ARG A . n A 1 28 LEU 28 273 273 LEU LEU A . n A 1 29 LEU 29 274 274 LEU LEU A . n A 1 30 PHE 30 275 275 PHE PHE A . n A 1 31 HIS 31 276 276 HIS HIS A . n A 1 32 GLY 32 277 277 GLY GLY A . n A 1 33 GLU 33 278 278 GLU GLU A . n A 1 34 GLN 34 279 279 GLN GLN A . n A 1 35 ALA 35 280 280 ALA ALA A . n A 1 36 LYS 36 281 281 LYS LYS A . n A 1 37 LEU 37 282 282 LEU LEU A . n A 1 38 PRO 38 283 283 PRO PRO A . n A 1 39 ILE 39 284 284 ILE ILE A . n A 1 40 ILE 40 285 285 ILE ILE A . n A 1 41 SER 41 286 286 SER SER A . n A 1 42 HIS 42 287 287 HIS HIS A . n A 1 43 ILE 43 288 288 ILE ILE A . n A 1 44 VAL 44 289 289 VAL VAL A . n A 1 45 GLN 45 290 290 GLN GLN A . n A 1 46 GLU 46 291 291 GLU GLU A . n A 1 47 TYR 47 292 292 TYR TYR A . n A 1 48 GLN 48 293 293 GLN GLN A . n A 1 49 VAL 49 294 294 VAL VAL A . n A 1 50 GLU 50 295 295 GLU GLU A . n A 1 51 VAL 51 296 296 VAL VAL A . n A 1 52 SER 52 297 297 SER SER A . n A 1 53 ILE 53 298 298 ILE ILE A . n A 1 54 ILE 54 299 299 ILE ILE A . n A 1 55 GLN 55 300 300 GLN GLN A . n A 1 56 GLY 56 301 301 GLY GLY A . n A 1 57 ASN 57 302 302 ASN ASN A . n A 1 58 ILE 58 303 303 ILE ILE A . n A 1 59 GLN 59 304 304 GLN GLN A . n A 1 60 GLN 60 305 305 GLN GLN A . n A 1 61 THR 61 306 306 THR THR A . n A 1 62 LYS 62 307 307 LYS LYS A . n A 1 63 GLN 63 308 308 GLN GLN A . n A 1 64 GLY 64 309 309 GLY GLY A . n A 1 65 ALA 65 310 310 ALA ALA A . n A 1 66 VAL 66 311 311 VAL VAL A . n A 1 67 GLY 67 312 312 GLY GLY A . n A 1 68 SER 68 313 313 SER SER A . n A 1 69 LEU 69 314 314 LEU LEU A . n A 1 70 TYR 70 315 315 TYR TYR A . n A 1 71 ILE 71 316 316 ILE ILE A . n A 1 72 GLN 72 317 317 GLN GLN A . n A 1 73 LEU 73 318 318 LEU LEU A . n A 1 74 LEU 74 319 319 LEU LEU A . n A 1 75 GLY 75 320 320 GLY GLY A . n A 1 76 GLU 76 321 321 GLU GLU A . n A 1 77 GLU 77 322 322 GLU GLU A . n A 1 78 GLN 78 323 323 GLN GLN A . n A 1 79 ASN 79 324 324 ASN ASN A . n A 1 80 ILE 80 325 325 ILE ILE A . n A 1 81 LEU 81 326 326 LEU LEU A . n A 1 82 ALA 82 327 327 ALA ALA A . n A 1 83 ALA 83 328 328 ALA ALA A . n A 1 84 ILE 84 329 329 ILE ILE A . n A 1 85 GLU 85 330 330 GLU GLU A . n A 1 86 GLY 86 331 331 GLY GLY A . n A 1 87 LEU 87 332 332 LEU LEU A . n A 1 88 ARG 88 333 333 ARG ARG A . n A 1 89 LYS 89 334 334 LYS LYS A . n A 1 90 LEU 90 335 335 LEU LEU A . n A 1 91 ARG 91 336 336 ARG ARG A . n A 1 92 VAL 92 337 337 VAL VAL A . n A 1 93 GLU 93 338 338 GLU GLU A . n A 1 94 THR 94 339 339 THR THR A . n A 1 95 GLU 95 340 340 GLU GLU A . n A 1 96 VAL 96 341 341 VAL VAL A . n A 1 97 ILE 97 342 342 ILE ILE A . n A 1 98 GLY 98 343 343 GLY GLY A . n A 1 99 ASN 99 344 344 ASN ASN A . n A 1 100 GLU 100 345 345 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 202 202 ZN ZN A . D 2 ZN 1 203 203 ZN ZN A . E 3 GOL 1 204 204 GOL GOL A . F 4 HOH 1 1 1 HOH HOH A . F 4 HOH 2 2 2 HOH HOH A . F 4 HOH 3 3 3 HOH HOH A . F 4 HOH 4 4 4 HOH HOH A . F 4 HOH 5 5 5 HOH HOH A . F 4 HOH 6 6 6 HOH HOH A . F 4 HOH 7 7 7 HOH HOH A . F 4 HOH 8 8 8 HOH HOH A . F 4 HOH 9 9 9 HOH HOH A . F 4 HOH 10 10 10 HOH HOH A . F 4 HOH 11 11 11 HOH HOH A . F 4 HOH 12 12 12 HOH HOH A . F 4 HOH 13 13 13 HOH HOH A . F 4 HOH 14 14 14 HOH HOH A . F 4 HOH 15 15 15 HOH HOH A . F 4 HOH 16 16 16 HOH HOH A . F 4 HOH 17 17 17 HOH HOH A . F 4 HOH 18 18 18 HOH HOH A . F 4 HOH 19 19 19 HOH HOH A . F 4 HOH 20 20 20 HOH HOH A . F 4 HOH 21 21 21 HOH HOH A . F 4 HOH 22 22 22 HOH HOH A . F 4 HOH 23 23 23 HOH HOH A . F 4 HOH 24 24 24 HOH HOH A . F 4 HOH 25 25 25 HOH HOH A . F 4 HOH 26 26 26 HOH HOH A . F 4 HOH 27 27 27 HOH HOH A . F 4 HOH 28 28 28 HOH HOH A . F 4 HOH 29 29 29 HOH HOH A . F 4 HOH 30 30 30 HOH HOH A . F 4 HOH 31 31 31 HOH HOH A . F 4 HOH 32 32 32 HOH HOH A . F 4 HOH 33 33 33 HOH HOH A . F 4 HOH 34 34 34 HOH HOH A . F 4 HOH 35 35 35 HOH HOH A . F 4 HOH 36 36 36 HOH HOH A . F 4 HOH 37 37 37 HOH HOH A . F 4 HOH 38 38 38 HOH HOH A . F 4 HOH 39 39 39 HOH HOH A . F 4 HOH 40 40 40 HOH HOH A . F 4 HOH 41 41 41 HOH HOH A . F 4 HOH 42 42 42 HOH HOH A . F 4 HOH 43 43 43 HOH HOH A . F 4 HOH 44 44 44 HOH HOH A . F 4 HOH 45 45 45 HOH HOH A . F 4 HOH 46 46 46 HOH HOH A . F 4 HOH 47 47 47 HOH HOH A . F 4 HOH 48 48 48 HOH HOH A . F 4 HOH 49 49 49 HOH HOH A . F 4 HOH 50 50 50 HOH HOH A . F 4 HOH 51 51 51 HOH HOH A . F 4 HOH 52 52 52 HOH HOH A . F 4 HOH 53 53 53 HOH HOH A . F 4 HOH 54 54 54 HOH HOH A . F 4 HOH 55 55 55 HOH HOH A . F 4 HOH 56 56 56 HOH HOH A . F 4 HOH 57 57 57 HOH HOH A . F 4 HOH 58 58 58 HOH HOH A . F 4 HOH 59 59 59 HOH HOH A . F 4 HOH 60 60 60 HOH HOH A . F 4 HOH 61 61 61 HOH HOH A . F 4 HOH 62 62 62 HOH HOH A . F 4 HOH 63 63 63 HOH HOH A . F 4 HOH 64 64 64 HOH HOH A . F 4 HOH 65 65 65 HOH HOH A . F 4 HOH 66 66 66 HOH HOH A . F 4 HOH 67 67 67 HOH HOH A . F 4 HOH 68 68 68 HOH HOH A . F 4 HOH 69 69 69 HOH HOH A . F 4 HOH 70 70 70 HOH HOH A . F 4 HOH 71 71 71 HOH HOH A . F 4 HOH 72 72 72 HOH HOH A . F 4 HOH 73 73 73 HOH HOH A . F 4 HOH 74 74 74 HOH HOH A . F 4 HOH 75 75 75 HOH HOH A . F 4 HOH 76 76 76 HOH HOH A . F 4 HOH 77 77 77 HOH HOH A . F 4 HOH 78 78 78 HOH HOH A . F 4 HOH 79 79 79 HOH HOH A . F 4 HOH 80 80 80 HOH HOH A . F 4 HOH 81 81 81 HOH HOH A . F 4 HOH 82 82 82 HOH HOH A . F 4 HOH 83 83 83 HOH HOH A . F 4 HOH 84 84 84 HOH HOH A . F 4 HOH 85 85 85 HOH HOH A . F 4 HOH 86 86 86 HOH HOH A . F 4 HOH 87 87 87 HOH HOH A . F 4 HOH 88 88 88 HOH HOH A . F 4 HOH 89 89 89 HOH HOH A . F 4 HOH 90 90 90 HOH HOH A . F 4 HOH 91 91 91 HOH HOH A . F 4 HOH 92 92 92 HOH HOH A . F 4 HOH 93 93 93 HOH HOH A . F 4 HOH 94 94 94 HOH HOH A . F 4 HOH 95 95 95 HOH HOH A . F 4 HOH 96 96 96 HOH HOH A . F 4 HOH 97 97 97 HOH HOH A . F 4 HOH 98 98 98 HOH HOH A . F 4 HOH 99 99 99 HOH HOH A . F 4 HOH 100 100 100 HOH HOH A . F 4 HOH 101 101 101 HOH HOH A . F 4 HOH 102 102 102 HOH HOH A . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 SBC-Collect 'data collection' . ? 2 HKL-3000 'data reduction' . ? 3 HKL-3000 'data scaling' . ? 4 SHELXD phasing . ? 5 MLPHARE phasing . ? 6 DM phasing . ? 7 SOLVE phasing . ? 8 RESOLVE phasing . ? 9 HKL-3000 phasing . ? 10 # _cell.entry_id 2QSW _cell.length_a 38.896 _cell.length_b 38.896 _cell.length_c 111.938 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2QSW _symmetry.space_group_name_H-M 'P 43 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 95 _symmetry.space_group_name_Hall ? # _exptl.entry_id 2QSW _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.88 _exptl_crystal.density_percent_sol 34.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pdbx_details '0.01 M Zinc sulfate, 0.1 M MES buffer pH 6.9, 25% PEG 550 MME, VAPOR DIFFUSION, SITTING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type SBC-3 _diffrn_detector.pdbx_collection_date 2007-07-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-BM _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97920 # _reflns.entry_id 2QSW _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.50 _reflns.d_resolution_low 26.80 _reflns.number_all 14492 _reflns.number_obs 14492 _reflns.percent_possible_obs 99.4 _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 45.5 _reflns.B_iso_Wilson_estimate 25.1 _reflns.pdbx_redundancy 11.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.53 _reflns_shell.percent_possible_all 94.2 _reflns_shell.Rmerge_I_obs 0.438 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.48 _reflns_shell.pdbx_redundancy 4.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 879 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2QSW _refine.ls_number_reflns_obs 13709 _refine.ls_number_reflns_all 13709 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 26.80 _refine.ls_d_res_high 1.50 _refine.ls_percent_reflns_obs 99.41 _refine.ls_R_factor_obs 0.1490 _refine.ls_R_factor_all 0.1490 _refine.ls_R_factor_R_work 0.1471 _refine.ls_R_factor_R_free 0.1842 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 728 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.974 _refine.correlation_coeff_Fo_to_Fc_free 0.966 _refine.B_iso_mean 14.295 _refine.aniso_B[1][1] 0.23 _refine.aniso_B[2][2] 0.23 _refine.aniso_B[3][3] -0.45 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.092 _refine.pdbx_overall_ESU_R_Free 0.073 _refine.overall_SU_ML 0.045 _refine.overall_SU_B 2.643 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 712 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 102 _refine_hist.number_atoms_total 823 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 26.80 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 830 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 562 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.704 1.982 ? 1144 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.471 3.000 ? 1412 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.666 5.000 ? 117 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.786 26.739 ? 46 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.215 15.000 ? 169 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 25.781 15.000 ? 4 'X-RAY DIFFRACTION' ? r_chiral_restr 0.195 0.200 ? 134 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 945 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 143 'X-RAY DIFFRACTION' ? r_nbd_refined 0.238 0.200 ? 162 'X-RAY DIFFRACTION' ? r_nbd_other 0.212 0.200 ? 646 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.173 0.200 ? 385 'X-RAY DIFFRACTION' ? r_nbtor_other 0.087 0.200 ? 452 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.182 0.200 ? 70 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.147 0.200 ? 6 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.272 0.200 ? 23 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.262 0.200 ? 73 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.312 0.200 ? 17 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined 0.087 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.743 1.500 ? 599 'X-RAY DIFFRACTION' ? r_mcbond_other 0.584 1.500 ? 200 'X-RAY DIFFRACTION' ? r_mcangle_it 2.107 2.000 ? 812 'X-RAY DIFFRACTION' ? r_scbond_it 3.180 3.000 ? 364 'X-RAY DIFFRACTION' ? r_scangle_it 4.597 4.500 ? 317 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 1.981 3.000 ? 1579 'X-RAY DIFFRACTION' ? r_sphericity_free 6.392 3.000 ? 106 'X-RAY DIFFRACTION' ? r_sphericity_bonded 2.745 3.000 ? 1370 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.500 _refine_ls_shell.d_res_low 1.539 _refine_ls_shell.number_reflns_R_work 931 _refine_ls_shell.R_factor_R_work 0.176 _refine_ls_shell.percent_reflns_obs 94.61 _refine_ls_shell.R_factor_R_free 0.219 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 52 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 983 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _database_PDB_matrix.entry_id 2QSW _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2QSW _struct.title 'Crystal structure of C-terminal domain of ABC transporter / ATP-binding protein from Enterococcus faecalis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2QSW _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;ABC transporter, ATP-binding protein, structural genomics, APC87322.1, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Amino-acid transport, Hydrolase, Membrane, Nucleotide-binding ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code METN2_ENTFA _struct_ref.pdbx_db_accession Q831K6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KNIEETELVVEEMLEQYPNGKIVRLLFHGEQAKLPIISHIVQEYQVEVSIIQGNIQQTKQGAVGSLYIQLLGEEQNILAA IEGLRKLRVETEVIGNE ; _struct_ref.pdbx_align_begin 249 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2QSW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q831K6 _struct_ref_seq.db_align_beg 249 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 249 _struct_ref_seq.pdbx_auth_seq_align_end 345 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2QSW SER A 1 ? UNP Q831K6 ? ? 'expression tag' 246 1 1 2QSW ASN A 2 ? UNP Q831K6 ? ? 'expression tag' 247 2 1 2QSW ALA A 3 ? UNP Q831K6 ? ? 'expression tag' 248 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 2530 _pdbx_struct_assembly_prop.details ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_755 -x+2,y,-z -1.0000000000 0.0000000000 0.0000000000 77.7920000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 12 ? TYR A 20 ? VAL A 257 TYR A 265 1 ? 9 HELX_P HELX_P2 2 PRO A 38 ? GLN A 48 ? PRO A 283 GLN A 293 1 ? 11 HELX_P HELX_P3 3 GLU A 76 ? LEU A 90 ? GLU A 321 LEU A 335 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLU 15 C ? ? ? 1_555 A MSE 16 N ? ? A GLU 260 A MSE 261 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale2 covale both ? A MSE 16 C ? ? ? 1_555 A LEU 17 N ? ? A MSE 261 A LEU 262 1_555 ? ? ? ? ? ? ? 1.345 ? ? metalc1 metalc ? ? F HOH . O ? ? ? 3_644 C ZN . ZN ? ? A HOH 3 A ZN 202 1_555 ? ? ? ? ? ? ? 2.092 ? ? metalc2 metalc ? ? F HOH . O ? ? ? 1_555 B ZN . ZN ? ? A HOH 66 A ZN 201 1_555 ? ? ? ? ? ? ? 2.122 ? ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 31 ND1 ? ? A ZN 201 A HIS 276 1_555 ? ? ? ? ? ? ? 1.934 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 33 OE2 ? ? A ZN 201 A GLU 278 1_555 ? ? ? ? ? ? ? 1.940 ? ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 93 OE1 ? ? A ZN 201 A GLU 338 1_555 ? ? ? ? ? ? ? 1.971 ? ? metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 18 OE1 ? ? A ZN 202 A GLU 263 3_644 ? ? ? ? ? ? ? 1.903 ? ? metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 42 NE2 ? ? A ZN 202 A HIS 287 1_555 ? ? ? ? ? ? ? 2.025 ? ? metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 46 OE1 ? ? A ZN 202 A GLU 291 1_555 ? ? ? ? ? ? ? 1.933 ? ? metalc9 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 95 OE1 ? ? A ZN 203 A GLU 340 1_555 ? ? ? ? ? ? ? 2.653 ? ? metalc10 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 95 OE2 ? ? A ZN 203 A GLU 340 1_555 ? ? ? ? ? ? ? 1.709 ? ? metalc11 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 95 OE2 ? ? A ZN 203 A GLU 340 5_755 ? ? ? ? ? ? ? 2.582 ? ? metalc12 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 100 OE1 ? ? A ZN 203 A GLU 345 1_555 ? ? ? ? ? ? ? 2.094 ? ? metalc13 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 100 OE1 ? ? A ZN 203 A GLU 345 5_755 ? ? ? ? ? ? ? 1.983 ? ? metalc14 metalc ? ? D ZN . ZN ? ? ? 1_555 A GLU 100 OE2 ? ? A ZN 203 A GLU 345 5_755 ? ? ? ? ? ? ? 2.268 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? F HOH . ? A HOH 3 ? 3_644 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 18 ? A GLU 263 ? 3_644 97.4 ? 2 O ? F HOH . ? A HOH 3 ? 3_644 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 42 ? A HIS 287 ? 1_555 102.5 ? 3 OE1 ? A GLU 18 ? A GLU 263 ? 3_644 ZN ? C ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 42 ? A HIS 287 ? 1_555 123.9 ? 4 O ? F HOH . ? A HOH 3 ? 3_644 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 46 ? A GLU 291 ? 1_555 107.3 ? 5 OE1 ? A GLU 18 ? A GLU 263 ? 3_644 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 46 ? A GLU 291 ? 1_555 124.1 ? 6 NE2 ? A HIS 42 ? A HIS 287 ? 1_555 ZN ? C ZN . ? A ZN 202 ? 1_555 OE1 ? A GLU 46 ? A GLU 291 ? 1_555 98.9 ? 7 O ? F HOH . ? A HOH 66 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 31 ? A HIS 276 ? 1_555 115.9 ? 8 O ? F HOH . ? A HOH 66 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 33 ? A GLU 278 ? 1_555 100.2 ? 9 ND1 ? A HIS 31 ? A HIS 276 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 33 ? A GLU 278 ? 1_555 124.7 ? 10 O ? F HOH . ? A HOH 66 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 93 ? A GLU 338 ? 1_555 91.2 ? 11 ND1 ? A HIS 31 ? A HIS 276 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 93 ? A GLU 338 ? 1_555 103.9 ? 12 OE2 ? A GLU 33 ? A GLU 278 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 93 ? A GLU 338 ? 1_555 116.3 ? 13 OE1 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 95 ? A GLU 340 ? 1_555 54.5 ? 14 OE1 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 95 ? A GLU 340 ? 5_755 74.2 ? 15 OE2 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 95 ? A GLU 340 ? 5_755 102.9 ? 16 OE1 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 1_555 141.2 ? 17 OE2 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 1_555 92.3 ? 18 OE2 ? A GLU 95 ? A GLU 340 ? 5_755 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 1_555 97.9 ? 19 OE1 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 5_755 94.0 ? 20 OE2 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 5_755 147.2 ? 21 OE2 ? A GLU 95 ? A GLU 340 ? 5_755 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 5_755 72.9 ? 22 OE1 ? A GLU 100 ? A GLU 345 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE1 ? A GLU 100 ? A GLU 345 ? 5_755 120.5 ? 23 OE1 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 100 ? A GLU 345 ? 5_755 102.6 ? 24 OE2 ? A GLU 95 ? A GLU 340 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 100 ? A GLU 345 ? 5_755 113.5 ? 25 OE2 ? A GLU 95 ? A GLU 340 ? 5_755 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 100 ? A GLU 345 ? 5_755 132.3 ? 26 OE1 ? A GLU 100 ? A GLU 345 ? 1_555 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 100 ? A GLU 345 ? 5_755 109.7 ? 27 OE1 ? A GLU 100 ? A GLU 345 ? 5_755 ZN ? D ZN . ? A ZN 203 ? 1_555 OE2 ? A GLU 100 ? A GLU 345 ? 5_755 59.7 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id MSE _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 16 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id MSE _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 261 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id MET _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id MSE _pdbx_modification_feature.type Selenomethionine _pdbx_modification_feature.category 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 11 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 256 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 VAL _struct_mon_prot_cis.pdbx_label_seq_id_2 12 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 VAL _struct_mon_prot_cis.pdbx_auth_seq_id_2 257 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.03 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 50 ? THR A 61 ? GLU A 295 THR A 306 A 2 GLY A 64 ? LEU A 74 ? GLY A 309 LEU A 319 A 3 LYS A 24 ? HIS A 31 ? LYS A 269 HIS A 276 A 4 GLU A 93 ? VAL A 96 ? GLU A 338 VAL A 341 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 55 ? N GLN A 300 O TYR A 70 ? O TYR A 315 A 2 3 O LEU A 73 ? O LEU A 318 N LYS A 24 ? N LYS A 269 A 3 4 N ARG A 27 ? N ARG A 272 O GLU A 95 ? O GLU A 340 # _pdbx_entry_details.entry_id 2QSW _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 70 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 70 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_664 _pdbx_validate_symm_contact.dist 1.99 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ARG _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 336 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 71.54 _pdbx_validate_torsion.psi 32.42 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id LEU _pdbx_validate_chiral.auth_seq_id 256 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id MSE _pdbx_struct_mod_residue.label_seq_id 16 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id MSE _pdbx_struct_mod_residue.auth_seq_id 261 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details SELENOMETHIONINE # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 57 ? F HOH . 2 1 A HOH 80 ? F HOH . 3 1 A HOH 91 ? F HOH . # _pdbx_database_remark.id 300 _pdbx_database_remark.text ; BIOMOLECULE: 1 SEE REMARK 350 FOR THE PROGRAM GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN THIS ENTRY. AUTHORS STATE THAT THE BIOLOGICAL UNIT OF THIS POLYPEPTIDE IS UNKNOWN. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 246 ? A SER 1 2 1 Y 1 A ASN 247 ? A ASN 2 3 1 Y 1 A ALA 248 ? A ALA 3 4 1 Y 1 A LYS 249 ? A LYS 4 5 1 Y 1 A ASN 250 ? A ASN 5 6 1 Y 1 A ILE 251 ? A ILE 6 7 1 Y 1 A GLU 252 ? A GLU 7 8 1 Y 1 A GLU 253 ? A GLU 8 9 1 Y 1 A THR 254 ? A THR 9 10 1 Y 1 A GLU 255 ? A GLU 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 GOL C1 C N N 107 GOL O1 O N N 108 GOL C2 C N N 109 GOL O2 O N N 110 GOL C3 C N N 111 GOL O3 O N N 112 GOL H11 H N N 113 GOL H12 H N N 114 GOL HO1 H N N 115 GOL H2 H N N 116 GOL HO2 H N N 117 GOL H31 H N N 118 GOL H32 H N N 119 GOL HO3 H N N 120 HIS N N N N 121 HIS CA C N S 122 HIS C C N N 123 HIS O O N N 124 HIS CB C N N 125 HIS CG C Y N 126 HIS ND1 N Y N 127 HIS CD2 C Y N 128 HIS CE1 C Y N 129 HIS NE2 N Y N 130 HIS OXT O N N 131 HIS H H N N 132 HIS H2 H N N 133 HIS HA H N N 134 HIS HB2 H N N 135 HIS HB3 H N N 136 HIS HD1 H N N 137 HIS HD2 H N N 138 HIS HE1 H N N 139 HIS HE2 H N N 140 HIS HXT H N N 141 HOH O O N N 142 HOH H1 H N N 143 HOH H2 H N N 144 ILE N N N N 145 ILE CA C N S 146 ILE C C N N 147 ILE O O N N 148 ILE CB C N S 149 ILE CG1 C N N 150 ILE CG2 C N N 151 ILE CD1 C N N 152 ILE OXT O N N 153 ILE H H N N 154 ILE H2 H N N 155 ILE HA H N N 156 ILE HB H N N 157 ILE HG12 H N N 158 ILE HG13 H N N 159 ILE HG21 H N N 160 ILE HG22 H N N 161 ILE HG23 H N N 162 ILE HD11 H N N 163 ILE HD12 H N N 164 ILE HD13 H N N 165 ILE HXT H N N 166 LEU N N N N 167 LEU CA C N S 168 LEU C C N N 169 LEU O O N N 170 LEU CB C N N 171 LEU CG C N N 172 LEU CD1 C N N 173 LEU CD2 C N N 174 LEU OXT O N N 175 LEU H H N N 176 LEU H2 H N N 177 LEU HA H N N 178 LEU HB2 H N N 179 LEU HB3 H N N 180 LEU HG H N N 181 LEU HD11 H N N 182 LEU HD12 H N N 183 LEU HD13 H N N 184 LEU HD21 H N N 185 LEU HD22 H N N 186 LEU HD23 H N N 187 LEU HXT H N N 188 LYS N N N N 189 LYS CA C N S 190 LYS C C N N 191 LYS O O N N 192 LYS CB C N N 193 LYS CG C N N 194 LYS CD C N N 195 LYS CE C N N 196 LYS NZ N N N 197 LYS OXT O N N 198 LYS H H N N 199 LYS H2 H N N 200 LYS HA H N N 201 LYS HB2 H N N 202 LYS HB3 H N N 203 LYS HG2 H N N 204 LYS HG3 H N N 205 LYS HD2 H N N 206 LYS HD3 H N N 207 LYS HE2 H N N 208 LYS HE3 H N N 209 LYS HZ1 H N N 210 LYS HZ2 H N N 211 LYS HZ3 H N N 212 LYS HXT H N N 213 MSE N N N N 214 MSE CA C N S 215 MSE C C N N 216 MSE O O N N 217 MSE OXT O N N 218 MSE CB C N N 219 MSE CG C N N 220 MSE SE SE N N 221 MSE CE C N N 222 MSE H H N N 223 MSE H2 H N N 224 MSE HA H N N 225 MSE HXT H N N 226 MSE HB2 H N N 227 MSE HB3 H N N 228 MSE HG2 H N N 229 MSE HG3 H N N 230 MSE HE1 H N N 231 MSE HE2 H N N 232 MSE HE3 H N N 233 PHE N N N N 234 PHE CA C N S 235 PHE C C N N 236 PHE O O N N 237 PHE CB C N N 238 PHE CG C Y N 239 PHE CD1 C Y N 240 PHE CD2 C Y N 241 PHE CE1 C Y N 242 PHE CE2 C Y N 243 PHE CZ C Y N 244 PHE OXT O N N 245 PHE H H N N 246 PHE H2 H N N 247 PHE HA H N N 248 PHE HB2 H N N 249 PHE HB3 H N N 250 PHE HD1 H N N 251 PHE HD2 H N N 252 PHE HE1 H N N 253 PHE HE2 H N N 254 PHE HZ H N N 255 PHE HXT H N N 256 PRO N N N N 257 PRO CA C N S 258 PRO C C N N 259 PRO O O N N 260 PRO CB C N N 261 PRO CG C N N 262 PRO CD C N N 263 PRO OXT O N N 264 PRO H H N N 265 PRO HA H N N 266 PRO HB2 H N N 267 PRO HB3 H N N 268 PRO HG2 H N N 269 PRO HG3 H N N 270 PRO HD2 H N N 271 PRO HD3 H N N 272 PRO HXT H N N 273 SER N N N N 274 SER CA C N S 275 SER C C N N 276 SER O O N N 277 SER CB C N N 278 SER OG O N N 279 SER OXT O N N 280 SER H H N N 281 SER H2 H N N 282 SER HA H N N 283 SER HB2 H N N 284 SER HB3 H N N 285 SER HG H N N 286 SER HXT H N N 287 THR N N N N 288 THR CA C N S 289 THR C C N N 290 THR O O N N 291 THR CB C N R 292 THR OG1 O N N 293 THR CG2 C N N 294 THR OXT O N N 295 THR H H N N 296 THR H2 H N N 297 THR HA H N N 298 THR HB H N N 299 THR HG1 H N N 300 THR HG21 H N N 301 THR HG22 H N N 302 THR HG23 H N N 303 THR HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 ZN ZN ZN N N 348 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 GOL C1 O1 sing N N 101 GOL C1 C2 sing N N 102 GOL C1 H11 sing N N 103 GOL C1 H12 sing N N 104 GOL O1 HO1 sing N N 105 GOL C2 O2 sing N N 106 GOL C2 C3 sing N N 107 GOL C2 H2 sing N N 108 GOL O2 HO2 sing N N 109 GOL C3 O3 sing N N 110 GOL C3 H31 sing N N 111 GOL C3 H32 sing N N 112 GOL O3 HO3 sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 HOH O H1 sing N N 135 HOH O H2 sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MSE N CA sing N N 203 MSE N H sing N N 204 MSE N H2 sing N N 205 MSE CA C sing N N 206 MSE CA CB sing N N 207 MSE CA HA sing N N 208 MSE C O doub N N 209 MSE C OXT sing N N 210 MSE OXT HXT sing N N 211 MSE CB CG sing N N 212 MSE CB HB2 sing N N 213 MSE CB HB3 sing N N 214 MSE CG SE sing N N 215 MSE CG HG2 sing N N 216 MSE CG HG3 sing N N 217 MSE SE CE sing N N 218 MSE CE HE1 sing N N 219 MSE CE HE2 sing N N 220 MSE CE HE3 sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # _atom_sites.entry_id 2QSW _atom_sites.fract_transf_matrix[1][1] 0.025710 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025710 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008934 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE ZN # loop_