data_2R32 # _entry.id 2R32 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2R32 RCSB RCSB044362 WWPDB D_1000044362 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2q1m . unspecified PDB 2R30 . unspecified # _pdbx_database_status.entry_id 2R32 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-28 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chattopadhyay, K.' 1 'Ramagopal, U.A.' 2 'Nathenson, S.G.' 3 'Almo, S.C.' 4 # _citation.id primary _citation.title 'Assembly and structural properties of glucocorticoid-induced TNF receptor ligand: Implications for function.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 104 _citation.page_first 19452 _citation.page_last 19457 _citation.year 2007 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18040044 _citation.pdbx_database_id_DOI 10.1073/pnas.0709264104 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Chattopadhyay, K.' 1 primary 'Ramagopal, U.A.' 2 primary 'Mukhopadhaya, A.' 3 primary 'Malashkevich, V.N.' 4 primary 'Dilorenzo, T.P.' 5 primary 'Brenowitz, M.' 6 primary 'Nathenson, S.G.' 7 primary 'Almo, S.C.' 8 # _cell.length_a 61.219 _cell.length_b 61.219 _cell.length_c 113.948 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 2R32 _cell.pdbx_unique_axis ? _cell.Z_PDB 9 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'H 3' _symmetry.entry_id 2R32 _symmetry.Int_Tables_number 146 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GCN4-pII/Tumor necrosis factor ligand superfamily member 18 fusion protein' 18917.713 1 ? ? 'TNF homology domain' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 48 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Glucocorticoid-induced TNF-related ligand, hGITRL, Activation-inducible TNF-related ligand, AITRL' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMGGSRMKQIEDKIEEILSKIYHIENEIARIKKLIGERETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQ NGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLA NPQFIS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGGSRMKQIEDKIEEILSKIYHIENEIARIKKLIGERETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQ NGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLA NPQFIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 GLY n 1 7 SER n 1 8 ARG n 1 9 MET n 1 10 LYS n 1 11 GLN n 1 12 ILE n 1 13 GLU n 1 14 ASP n 1 15 LYS n 1 16 ILE n 1 17 GLU n 1 18 GLU n 1 19 ILE n 1 20 LEU n 1 21 SER n 1 22 LYS n 1 23 ILE n 1 24 TYR n 1 25 HIS n 1 26 ILE n 1 27 GLU n 1 28 ASN n 1 29 GLU n 1 30 ILE n 1 31 ALA n 1 32 ARG n 1 33 ILE n 1 34 LYS n 1 35 LYS n 1 36 LEU n 1 37 ILE n 1 38 GLY n 1 39 GLU n 1 40 ARG n 1 41 GLU n 1 42 THR n 1 43 ALA n 1 44 LYS n 1 45 GLU n 1 46 PRO n 1 47 CYS n 1 48 MET n 1 49 ALA n 1 50 LYS n 1 51 PHE n 1 52 GLY n 1 53 PRO n 1 54 LEU n 1 55 PRO n 1 56 SER n 1 57 LYS n 1 58 TRP n 1 59 GLN n 1 60 MET n 1 61 ALA n 1 62 SER n 1 63 SER n 1 64 GLU n 1 65 PRO n 1 66 PRO n 1 67 CYS n 1 68 VAL n 1 69 ASN n 1 70 LYS n 1 71 VAL n 1 72 SER n 1 73 ASP n 1 74 TRP n 1 75 LYS n 1 76 LEU n 1 77 GLU n 1 78 ILE n 1 79 LEU n 1 80 GLN n 1 81 ASN n 1 82 GLY n 1 83 LEU n 1 84 TYR n 1 85 LEU n 1 86 ILE n 1 87 TYR n 1 88 GLY n 1 89 GLN n 1 90 VAL n 1 91 ALA n 1 92 PRO n 1 93 ASN n 1 94 ALA n 1 95 ASN n 1 96 TYR n 1 97 ASN n 1 98 ASP n 1 99 VAL n 1 100 ALA n 1 101 PRO n 1 102 PHE n 1 103 GLU n 1 104 VAL n 1 105 ARG n 1 106 LEU n 1 107 TYR n 1 108 LYS n 1 109 ASN n 1 110 LYS n 1 111 ASP n 1 112 MET n 1 113 ILE n 1 114 GLN n 1 115 THR n 1 116 LEU n 1 117 THR n 1 118 ASN n 1 119 LYS n 1 120 SER n 1 121 LYS n 1 122 ILE n 1 123 GLN n 1 124 ASN n 1 125 VAL n 1 126 GLY n 1 127 GLY n 1 128 THR n 1 129 TYR n 1 130 GLU n 1 131 LEU n 1 132 HIS n 1 133 VAL n 1 134 GLY n 1 135 ASP n 1 136 THR n 1 137 ILE n 1 138 ASP n 1 139 LEU n 1 140 ILE n 1 141 PHE n 1 142 ASN n 1 143 SER n 1 144 GLU n 1 145 HIS n 1 146 GLN n 1 147 VAL n 1 148 LEU n 1 149 LYS n 1 150 ASN n 1 151 ASN n 1 152 THR n 1 153 TYR n 1 154 TRP n 1 155 GLY n 1 156 ILE n 1 157 ILE n 1 158 LEU n 1 159 LEU n 1 160 ALA n 1 161 ASN n 1 162 PRO n 1 163 GLN n 1 164 PHE n 1 165 ILE n 1 166 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast, human ; _entity_src_gen.gene_src_genus 'Saccharomyces, Homo' _entity_src_gen.pdbx_gene_src_gene 'TNFSF18, AITRL, GITRL, TL6' _entity_src_gen.gene_src_species , _entity_src_gen.gene_src_strain , _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae, Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932,9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta (DE3) pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-14b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNF18_HUMAN _struct_ref.pdbx_db_accession Q9UNG2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKS KIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS ; _struct_ref.pdbx_align_begin 52 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2R32 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 41 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 166 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UNG2 _struct_ref_seq.db_align_beg 52 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 177 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 52 _struct_ref_seq.pdbx_auth_seq_align_end 177 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2R32 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 43.37 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details '2.0 M Ammonium Sulphate, Vapor diffusion, Sitting drop, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2007-04-28 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.072 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_wavelength_list 1.072 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A # _reflns.entry_id 2R32 _reflns.d_resolution_high 1.950 _reflns.d_resolution_low 50.000 _reflns.number_obs 11656 _reflns.pdbx_Rmerge_I_obs 0.077 _reflns.pdbx_netI_over_sigmaI 13.400 _reflns.pdbx_chi_squared 1.142 _reflns.pdbx_redundancy 5.900 _reflns.percent_possible_obs 99.800 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.number_all 11656 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.95 2.02 ? ? ? 0.491 ? ? 0.708 5.70 ? 1165 99.60 ? 1 2.02 2.10 ? ? ? 0.346 ? ? 0.807 6.00 ? 1152 100.00 ? 2 2.10 2.20 ? ? ? 0.264 ? ? 0.909 6.00 ? 1181 100.00 ? 3 2.20 2.31 ? ? ? 0.196 ? ? 1.083 6.00 ? 1144 100.00 ? 4 2.31 2.46 ? ? ? 0.155 ? ? 1.186 6.10 ? 1199 100.00 ? 5 2.46 2.65 ? ? ? 0.118 ? ? 1.279 6.10 ? 1166 100.00 ? 6 2.65 2.91 ? ? ? 0.084 ? ? 1.283 6.00 ? 1154 100.00 ? 7 2.91 3.33 ? ? ? 0.064 ? ? 1.239 6.00 ? 1162 100.00 ? 8 3.33 4.20 ? ? ? 0.059 ? ? 1.386 5.80 ? 1170 100.00 ? 9 4.20 50.00 ? ? ? 0.074 ? ? 1.550 5.60 ? 1163 98.90 ? 10 # _refine.entry_id 2R32 _refine.ls_d_res_high 1.950 _refine.ls_d_res_low 48.060 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.850 _refine.ls_number_reflns_obs 11656 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.201 _refine.ls_R_factor_R_work 0.199 _refine.ls_R_factor_R_free 0.246 _refine.ls_percent_reflns_R_free 4.800 _refine.ls_number_reflns_R_free 554 _refine.B_iso_mean 47.232 _refine.aniso_B[1][1] -1.190 _refine.aniso_B[2][2] -1.190 _refine.aniso_B[3][3] 1.790 _refine.aniso_B[1][2] -0.600 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.959 _refine.correlation_coeff_Fo_to_Fc_free 0.929 _refine.pdbx_overall_ESU_R 0.169 _refine.pdbx_overall_ESU_R_Free 0.158 _refine.overall_SU_ML 0.109 _refine.overall_SU_B 3.693 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I 0 _refine.ls_number_reflns_all 11656 _refine.ls_R_factor_all 0.201 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model 2q1m _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1125 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 48 _refine_hist.number_atoms_total 1178 _refine_hist.d_res_high 1.950 _refine_hist.d_res_low 48.060 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 1153 0.013 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1558 1.534 1.960 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 136 6.531 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 50 33.435 25.600 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 211 18.103 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 3 22.244 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 175 0.103 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 831 0.006 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 454 0.220 0.300 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 779 0.326 0.500 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 94 0.139 0.500 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 56 0.203 0.300 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 17 0.225 0.500 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 722 4.537 2.000 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1130 5.946 3.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 499 4.736 2.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 428 6.254 3.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.947 _refine_ls_shell.d_res_low 1.997 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 99.540 _refine_ls_shell.number_reflns_R_work 813 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.218 _refine_ls_shell.R_factor_R_free 0.324 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 860 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2R32 _struct.title 'Crystal Structure of human GITRL variant' _struct.pdbx_descriptor 'GCN4-pII/Tumor necrosis factor ligand superfamily member 18 fusion protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2R32 _struct_keywords.text 'GITRL, Glucocorticoid-Induced TNF Receptor Ligand, Cytokine, Glycoprotein, Membrane, Signal-anchor, Transmembrane, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological unit is a trimer' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 8 ? LEU A 36 ? ARG A 19 LEU A 47 1 ? 29 HELX_P HELX_P2 2 SER A 143 ? VAL A 147 ? SER A 154 VAL A 158 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 47 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 67 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 58 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 78 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.020 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 52 A . ? GLY 63 A PRO 53 A ? PRO 64 A 1 -0.93 2 LEU 54 A . ? LEU 65 A PRO 55 A ? PRO 66 A 1 15.27 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? C ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel C 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 58 ? ALA A 61 ? TRP A 69 ALA A 72 A 2 MET A 48 ? PHE A 51 ? MET A 59 PHE A 62 A 3 TYR A 153 ? ALA A 160 ? TYR A 164 ALA A 171 A 4 GLY A 82 ? VAL A 90 ? GLY A 93 VAL A 101 A 5 GLN A 123 ? ASN A 124 ? GLN A 134 ASN A 135 B 1 TRP A 58 ? ALA A 61 ? TRP A 69 ALA A 72 B 2 MET A 48 ? PHE A 51 ? MET A 59 PHE A 62 B 3 TYR A 153 ? ALA A 160 ? TYR A 164 ALA A 171 B 4 GLY A 82 ? VAL A 90 ? GLY A 93 VAL A 101 B 5 GLY A 127 ? LEU A 131 ? GLY A 138 LEU A 142 C 1 VAL A 68 ? SER A 72 ? VAL A 79 SER A 83 C 2 LYS A 75 ? ILE A 78 ? LYS A 86 ILE A 89 C 3 THR A 136 ? PHE A 141 ? THR A 147 PHE A 152 C 4 VAL A 104 ? LYS A 108 ? VAL A 115 LYS A 119 C 5 ASP A 111 ? LEU A 116 ? ASP A 122 LEU A 127 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 59 ? O GLN A 70 N LYS A 50 ? N LYS A 61 A 2 3 N PHE A 51 ? N PHE A 62 O TRP A 154 ? O TRP A 165 A 3 4 O ALA A 160 ? O ALA A 171 N LEU A 83 ? N LEU A 94 A 4 5 N VAL A 90 ? N VAL A 101 O GLN A 123 ? O GLN A 134 B 1 2 O GLN A 59 ? O GLN A 70 N LYS A 50 ? N LYS A 61 B 2 3 N PHE A 51 ? N PHE A 62 O TRP A 154 ? O TRP A 165 B 3 4 O ALA A 160 ? O ALA A 171 N LEU A 83 ? N LEU A 94 B 4 5 N TYR A 84 ? N TYR A 95 O TYR A 129 ? O TYR A 140 C 1 2 N ASN A 69 ? N ASN A 80 O GLU A 77 ? O GLU A 88 C 2 3 N LEU A 76 ? N LEU A 87 O ILE A 137 ? O ILE A 148 C 3 4 O ASP A 138 ? O ASP A 149 N TYR A 107 ? N TYR A 118 C 4 5 N LEU A 106 ? N LEU A 117 O ILE A 113 ? O ILE A 124 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 25 ? HIS A 36 . ? 1_555 ? 2 AC1 4 ASN A 28 ? ASN A 39 . ? 1_555 ? 3 AC1 4 ARG A 32 ? ARG A 43 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 183 . ? 6_445 ? # _atom_sites.entry_id 2R32 _atom_sites.fract_transf_matrix[1][1] 0.016335 _atom_sites.fract_transf_matrix[1][2] 0.009431 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018862 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008776 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 12 ? ? ? A . n A 1 2 SER 2 13 ? ? ? A . n A 1 3 HIS 3 14 ? ? ? A . n A 1 4 MET 4 15 ? ? ? A . n A 1 5 GLY 5 16 ? ? ? A . n A 1 6 GLY 6 17 ? ? ? A . n A 1 7 SER 7 18 ? ? ? A . n A 1 8 ARG 8 19 19 ARG ARG A . n A 1 9 MET 9 20 20 MET MET A . n A 1 10 LYS 10 21 21 LYS LYS A . n A 1 11 GLN 11 22 22 GLN GLN A . n A 1 12 ILE 12 23 23 ILE ILE A . n A 1 13 GLU 13 24 24 GLU GLU A . n A 1 14 ASP 14 25 25 ASP ASP A . n A 1 15 LYS 15 26 26 LYS LYS A . n A 1 16 ILE 16 27 27 ILE ILE A . n A 1 17 GLU 17 28 28 GLU GLU A . n A 1 18 GLU 18 29 29 GLU GLU A . n A 1 19 ILE 19 30 30 ILE ILE A . n A 1 20 LEU 20 31 31 LEU LEU A . n A 1 21 SER 21 32 32 SER SER A . n A 1 22 LYS 22 33 33 LYS LYS A . n A 1 23 ILE 23 34 34 ILE ILE A . n A 1 24 TYR 24 35 35 TYR TYR A . n A 1 25 HIS 25 36 36 HIS HIS A . n A 1 26 ILE 26 37 37 ILE ILE A . n A 1 27 GLU 27 38 38 GLU GLU A . n A 1 28 ASN 28 39 39 ASN ASN A . n A 1 29 GLU 29 40 40 GLU GLU A . n A 1 30 ILE 30 41 41 ILE ILE A . n A 1 31 ALA 31 42 42 ALA ALA A . n A 1 32 ARG 32 43 43 ARG ARG A . n A 1 33 ILE 33 44 44 ILE ILE A . n A 1 34 LYS 34 45 45 LYS LYS A . n A 1 35 LYS 35 46 46 LYS LYS A . n A 1 36 LEU 36 47 47 LEU LEU A . n A 1 37 ILE 37 48 ? ? ? A . n A 1 38 GLY 38 49 ? ? ? A . n A 1 39 GLU 39 50 ? ? ? A . n A 1 40 ARG 40 51 ? ? ? A . n A 1 41 GLU 41 52 ? ? ? A . n A 1 42 THR 42 53 ? ? ? A . n A 1 43 ALA 43 54 ? ? ? A . n A 1 44 LYS 44 55 ? ? ? A . n A 1 45 GLU 45 56 ? ? ? A . n A 1 46 PRO 46 57 57 PRO PRO A . n A 1 47 CYS 47 58 58 CYS CYS A . n A 1 48 MET 48 59 59 MET MET A . n A 1 49 ALA 49 60 60 ALA ALA A . n A 1 50 LYS 50 61 61 LYS LYS A . n A 1 51 PHE 51 62 62 PHE PHE A . n A 1 52 GLY 52 63 63 GLY GLY A . n A 1 53 PRO 53 64 64 PRO PRO A . n A 1 54 LEU 54 65 65 LEU LEU A . n A 1 55 PRO 55 66 66 PRO PRO A . n A 1 56 SER 56 67 67 SER SER A . n A 1 57 LYS 57 68 68 LYS LYS A . n A 1 58 TRP 58 69 69 TRP TRP A . n A 1 59 GLN 59 70 70 GLN GLN A . n A 1 60 MET 60 71 71 MET MET A . n A 1 61 ALA 61 72 72 ALA ALA A . n A 1 62 SER 62 73 ? ? ? A . n A 1 63 SER 63 74 ? ? ? A . n A 1 64 GLU 64 75 ? ? ? A . n A 1 65 PRO 65 76 76 PRO PRO A . n A 1 66 PRO 66 77 77 PRO PRO A . n A 1 67 CYS 67 78 78 CYS CYS A . n A 1 68 VAL 68 79 79 VAL VAL A . n A 1 69 ASN 69 80 80 ASN ASN A . n A 1 70 LYS 70 81 81 LYS LYS A . n A 1 71 VAL 71 82 82 VAL VAL A . n A 1 72 SER 72 83 83 SER SER A . n A 1 73 ASP 73 84 84 ASP ASP A . n A 1 74 TRP 74 85 85 TRP TRP A . n A 1 75 LYS 75 86 86 LYS LYS A . n A 1 76 LEU 76 87 87 LEU LEU A . n A 1 77 GLU 77 88 88 GLU GLU A . n A 1 78 ILE 78 89 89 ILE ILE A . n A 1 79 LEU 79 90 90 LEU LEU A . n A 1 80 GLN 80 91 91 GLN GLN A . n A 1 81 ASN 81 92 92 ASN ASN A . n A 1 82 GLY 82 93 93 GLY GLY A . n A 1 83 LEU 83 94 94 LEU LEU A . n A 1 84 TYR 84 95 95 TYR TYR A . n A 1 85 LEU 85 96 96 LEU LEU A . n A 1 86 ILE 86 97 97 ILE ILE A . n A 1 87 TYR 87 98 98 TYR TYR A . n A 1 88 GLY 88 99 99 GLY GLY A . n A 1 89 GLN 89 100 100 GLN GLN A . n A 1 90 VAL 90 101 101 VAL VAL A . n A 1 91 ALA 91 102 102 ALA ALA A . n A 1 92 PRO 92 103 103 PRO PRO A . n A 1 93 ASN 93 104 104 ASN ASN A . n A 1 94 ALA 94 105 ? ? ? A . n A 1 95 ASN 95 106 ? ? ? A . n A 1 96 TYR 96 107 ? ? ? A . n A 1 97 ASN 97 108 ? ? ? A . n A 1 98 ASP 98 109 ? ? ? A . n A 1 99 VAL 99 110 ? ? ? A . n A 1 100 ALA 100 111 111 ALA ALA A . n A 1 101 PRO 101 112 112 PRO PRO A . n A 1 102 PHE 102 113 113 PHE PHE A . n A 1 103 GLU 103 114 114 GLU GLU A . n A 1 104 VAL 104 115 115 VAL VAL A . n A 1 105 ARG 105 116 116 ARG ARG A . n A 1 106 LEU 106 117 117 LEU LEU A . n A 1 107 TYR 107 118 118 TYR TYR A . n A 1 108 LYS 108 119 119 LYS LYS A . n A 1 109 ASN 109 120 120 ASN ASN A . n A 1 110 LYS 110 121 121 LYS LYS A . n A 1 111 ASP 111 122 122 ASP ASP A . n A 1 112 MET 112 123 123 MET MET A . n A 1 113 ILE 113 124 124 ILE ILE A . n A 1 114 GLN 114 125 125 GLN GLN A . n A 1 115 THR 115 126 126 THR THR A . n A 1 116 LEU 116 127 127 LEU LEU A . n A 1 117 THR 117 128 128 THR THR A . n A 1 118 ASN 118 129 129 ASN ASN A . n A 1 119 LYS 119 130 130 LYS LYS A . n A 1 120 SER 120 131 131 SER SER A . n A 1 121 LYS 121 132 132 LYS LYS A . n A 1 122 ILE 122 133 133 ILE ILE A . n A 1 123 GLN 123 134 134 GLN GLN A . n A 1 124 ASN 124 135 135 ASN ASN A . n A 1 125 VAL 125 136 136 VAL VAL A . n A 1 126 GLY 126 137 137 GLY GLY A . n A 1 127 GLY 127 138 138 GLY GLY A . n A 1 128 THR 128 139 139 THR THR A . n A 1 129 TYR 129 140 140 TYR TYR A . n A 1 130 GLU 130 141 141 GLU GLU A . n A 1 131 LEU 131 142 142 LEU LEU A . n A 1 132 HIS 132 143 143 HIS HIS A . n A 1 133 VAL 133 144 144 VAL VAL A . n A 1 134 GLY 134 145 145 GLY GLY A . n A 1 135 ASP 135 146 146 ASP ASP A . n A 1 136 THR 136 147 147 THR THR A . n A 1 137 ILE 137 148 148 ILE ILE A . n A 1 138 ASP 138 149 149 ASP ASP A . n A 1 139 LEU 139 150 150 LEU LEU A . n A 1 140 ILE 140 151 151 ILE ILE A . n A 1 141 PHE 141 152 152 PHE PHE A . n A 1 142 ASN 142 153 153 ASN ASN A . n A 1 143 SER 143 154 154 SER SER A . n A 1 144 GLU 144 155 155 GLU GLU A . n A 1 145 HIS 145 156 156 HIS HIS A . n A 1 146 GLN 146 157 157 GLN GLN A . n A 1 147 VAL 147 158 158 VAL VAL A . n A 1 148 LEU 148 159 159 LEU LEU A . n A 1 149 LYS 149 160 160 LYS LYS A . n A 1 150 ASN 150 161 161 ASN ASN A . n A 1 151 ASN 151 162 162 ASN ASN A . n A 1 152 THR 152 163 163 THR THR A . n A 1 153 TYR 153 164 164 TYR TYR A . n A 1 154 TRP 154 165 165 TRP TRP A . n A 1 155 GLY 155 166 166 GLY GLY A . n A 1 156 ILE 156 167 167 ILE ILE A . n A 1 157 ILE 157 168 168 ILE ILE A . n A 1 158 LEU 158 169 169 LEU LEU A . n A 1 159 LEU 159 170 170 LEU LEU A . n A 1 160 ALA 160 171 171 ALA ALA A . n A 1 161 ASN 161 172 172 ASN ASN A . n A 1 162 PRO 162 173 173 PRO PRO A . n A 1 163 GLN 163 174 174 GLN GLN A . n A 1 164 PHE 164 175 175 PHE PHE A . n A 1 165 ILE 165 176 176 ILE ILE A . n A 1 166 SER 166 177 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 1 1 SO4 SO4 A . C 3 HOH 1 178 2 HOH HOH A . C 3 HOH 2 179 3 HOH HOH A . C 3 HOH 3 180 4 HOH HOH A . C 3 HOH 4 181 5 HOH HOH A . C 3 HOH 5 182 6 HOH HOH A . C 3 HOH 6 183 7 HOH HOH A . C 3 HOH 7 184 9 HOH HOH A . C 3 HOH 8 185 10 HOH HOH A . C 3 HOH 9 186 11 HOH HOH A . C 3 HOH 10 187 12 HOH HOH A . C 3 HOH 11 188 13 HOH HOH A . C 3 HOH 12 189 14 HOH HOH A . C 3 HOH 13 190 15 HOH HOH A . C 3 HOH 14 191 16 HOH HOH A . C 3 HOH 15 192 17 HOH HOH A . C 3 HOH 16 193 18 HOH HOH A . C 3 HOH 17 194 19 HOH HOH A . C 3 HOH 18 195 21 HOH HOH A . C 3 HOH 19 196 22 HOH HOH A . C 3 HOH 20 197 23 HOH HOH A . C 3 HOH 21 198 24 HOH HOH A . C 3 HOH 22 199 25 HOH HOH A . C 3 HOH 23 200 27 HOH HOH A . C 3 HOH 24 201 28 HOH HOH A . C 3 HOH 25 202 29 HOH HOH A . C 3 HOH 26 203 30 HOH HOH A . C 3 HOH 27 204 31 HOH HOH A . C 3 HOH 28 205 33 HOH HOH A . C 3 HOH 29 206 34 HOH HOH A . C 3 HOH 30 207 35 HOH HOH A . C 3 HOH 31 208 36 HOH HOH A . C 3 HOH 32 209 38 HOH HOH A . C 3 HOH 33 210 39 HOH HOH A . C 3 HOH 34 211 40 HOH HOH A . C 3 HOH 35 212 41 HOH HOH A . C 3 HOH 36 213 43 HOH HOH A . C 3 HOH 37 214 44 HOH HOH A . C 3 HOH 38 215 45 HOH HOH A . C 3 HOH 39 216 46 HOH HOH A . C 3 HOH 40 217 47 HOH HOH A . C 3 HOH 41 218 51 HOH HOH A . C 3 HOH 42 219 52 HOH HOH A . C 3 HOH 43 220 53 HOH HOH A . C 3 HOH 44 221 54 HOH HOH A . C 3 HOH 45 222 56 HOH HOH A . C 3 HOH 46 223 57 HOH HOH A . C 3 HOH 47 224 60 HOH HOH A . C 3 HOH 48 225 61 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_prop.biol_id 1 _pdbx_struct_assembly_prop.type 'ABSA (A^2)' _pdbx_struct_assembly_prop.value 6800 _pdbx_struct_assembly_prop.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_445 -y-1,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 -30.6095000000 0.8660254038 -0.5000000000 0.0000000000 -53.0172091943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_545 -x+y,-x-1,z -0.5000000000 0.8660254038 0.0000000000 30.6095000000 -0.8660254038 -0.5000000000 0.0000000000 -53.0172091943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-11-20 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_software.classification' 2 3 'Structure model' '_software.contact_author' 3 3 'Structure model' '_software.contact_author_email' 4 3 'Structure model' '_software.date' 5 3 'Structure model' '_software.language' 6 3 'Structure model' '_software.location' 7 3 'Structure model' '_software.name' 8 3 'Structure model' '_software.type' 9 3 'Structure model' '_software.version' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 3 PDB_EXTRACT 3.000 'July 2, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 4 CBASS . ? ? ? ? 'data collection' ? ? ? 5 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 6 MOLREP . ? ? ? ? phasing ? ? ? 7 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The sequence RMKQIEDKIEEILSKIYHIENEIARIKKLIGER corresponds to the coiled-coil protein structural motif of GCN4-pII, and is fused at the N-terminus of TNF18_HUMAN. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 68 ? ? -110.05 -122.75 2 1 TRP A 85 ? ? 83.27 -0.39 3 1 ASN A 120 ? ? 50.98 -122.91 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 28 ? OE1 ? A GLU 17 OE1 2 1 Y 1 A GLU 28 ? OE2 ? A GLU 17 OE2 3 1 Y 1 A GLU 29 ? CG ? A GLU 18 CG 4 1 Y 1 A GLU 29 ? CD ? A GLU 18 CD 5 1 Y 1 A GLU 29 ? OE1 ? A GLU 18 OE1 6 1 Y 1 A GLU 29 ? OE2 ? A GLU 18 OE2 7 1 Y 1 A LYS 130 ? CD ? A LYS 119 CD 8 1 Y 1 A LYS 130 ? CE ? A LYS 119 CE 9 1 Y 1 A LYS 130 ? NZ ? A LYS 119 NZ 10 1 Y 1 A LYS 132 ? CD ? A LYS 121 CD 11 1 Y 1 A LYS 132 ? CE ? A LYS 121 CE 12 1 Y 1 A LYS 132 ? NZ ? A LYS 121 NZ 13 1 Y 1 A LYS 160 ? CD ? A LYS 149 CD 14 1 Y 1 A LYS 160 ? CE ? A LYS 149 CE 15 1 Y 1 A LYS 160 ? NZ ? A LYS 149 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 12 ? A GLY 1 2 1 Y 1 A SER 13 ? A SER 2 3 1 Y 1 A HIS 14 ? A HIS 3 4 1 Y 1 A MET 15 ? A MET 4 5 1 Y 1 A GLY 16 ? A GLY 5 6 1 Y 1 A GLY 17 ? A GLY 6 7 1 Y 1 A SER 18 ? A SER 7 8 1 Y 1 A ILE 48 ? A ILE 37 9 1 Y 1 A GLY 49 ? A GLY 38 10 1 Y 1 A GLU 50 ? A GLU 39 11 1 Y 1 A ARG 51 ? A ARG 40 12 1 Y 1 A GLU 52 ? A GLU 41 13 1 Y 1 A THR 53 ? A THR 42 14 1 Y 1 A ALA 54 ? A ALA 43 15 1 Y 1 A LYS 55 ? A LYS 44 16 1 Y 1 A GLU 56 ? A GLU 45 17 1 Y 1 A SER 73 ? A SER 62 18 1 Y 1 A SER 74 ? A SER 63 19 1 Y 1 A GLU 75 ? A GLU 64 20 1 Y 1 A ALA 105 ? A ALA 94 21 1 Y 1 A ASN 106 ? A ASN 95 22 1 Y 1 A TYR 107 ? A TYR 96 23 1 Y 1 A ASN 108 ? A ASN 97 24 1 Y 1 A ASP 109 ? A ASP 98 25 1 Y 1 A VAL 110 ? A VAL 99 26 1 Y 1 A SER 177 ? A SER 166 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH #