data_2R76 # _entry.id 2R76 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2R76 RCSB RCSB044509 WWPDB D_1000044509 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SoR91A _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2R76 _pdbx_database_status.recvd_initial_deposition_date 2007-09-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Chen, Y.' 2 'Seetharaman, J.' 3 'Mao, L.' 4 'Maglaqui, M.' 5 'Owen, L.A.' 6 'Cunningham, K.' 7 'Fang, Y.' 8 'Xiao, R.' 9 'Baran, M.C.' 10 'Acton, T.B.' 11 'Montelione, G.T.' 12 'Hunt, J.F.' 13 'Tong, L.' 14 'Northeast Structural Genomics Consortium (NESG)' 15 # _citation.id primary _citation.title 'Crystal structure of the rare lipoprotein B (SO_1173) from Shewanella oneidensis.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Forouhar, F.' 1 primary 'Chen, Y.' 2 primary 'Seetharaman, J.' 3 primary 'Mao, L.' 4 primary 'Maglaqui, M.' 5 primary 'Owen, L.A.' 6 primary 'Cunningham, K.' 7 primary 'Fang, Y.' 8 primary 'Xiao, R.' 9 primary 'Baran, M.C.' 10 primary 'Acton, T.B.' 11 primary 'Montelione, G.T.' 12 primary 'Hunt, J.F.' 13 primary 'Tong, L.' 14 # _cell.entry_id 2R76 _cell.length_a 88.091 _cell.length_b 88.091 _cell.length_c 112.235 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2R76 _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rare lipoprotein B' 17886.775 2 ? S47K 'Residues 22-164' ? 2 water nat water 18.015 38 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GFKLQRSYQIPEQLNQLSLSSSDEYKELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAE YELIYFVEFAVALPGKEAQPFKIEIRRDYLDDPRTALAKSRE(MSE)ELLVKE(MSE)RIQAADRILQS(MSE)ASTEVN LEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGFKLQRSYQIPEQLNQLSLSSSDEYKELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEYELI YFVEFAVALPGKEAQPFKIEIRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMASTEVNLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier SoR91A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 PHE n 1 4 LYS n 1 5 LEU n 1 6 GLN n 1 7 ARG n 1 8 SER n 1 9 TYR n 1 10 GLN n 1 11 ILE n 1 12 PRO n 1 13 GLU n 1 14 GLN n 1 15 LEU n 1 16 ASN n 1 17 GLN n 1 18 LEU n 1 19 SER n 1 20 LEU n 1 21 SER n 1 22 SER n 1 23 SER n 1 24 ASP n 1 25 GLU n 1 26 TYR n 1 27 LYS n 1 28 GLU n 1 29 LEU n 1 30 THR n 1 31 ARG n 1 32 LEU n 1 33 VAL n 1 34 ARG n 1 35 GLU n 1 36 ARG n 1 37 LEU n 1 38 ARG n 1 39 LEU n 1 40 ASN n 1 41 ASN n 1 42 VAL n 1 43 LYS n 1 44 ILE n 1 45 VAL n 1 46 ASP n 1 47 ALA n 1 48 ALA n 1 49 ASN n 1 50 ASP n 1 51 VAL n 1 52 PRO n 1 53 VAL n 1 54 LEU n 1 55 ARG n 1 56 LEU n 1 57 ILE n 1 58 THR n 1 59 ASP n 1 60 SER n 1 61 LEU n 1 62 GLU n 1 63 ARG n 1 64 SER n 1 65 THR n 1 66 LEU n 1 67 SER n 1 68 LEU n 1 69 TYR n 1 70 PRO n 1 71 THR n 1 72 GLY n 1 73 ASN n 1 74 VAL n 1 75 ALA n 1 76 GLU n 1 77 TYR n 1 78 GLU n 1 79 LEU n 1 80 ILE n 1 81 TYR n 1 82 PHE n 1 83 VAL n 1 84 GLU n 1 85 PHE n 1 86 ALA n 1 87 VAL n 1 88 ALA n 1 89 LEU n 1 90 PRO n 1 91 GLY n 1 92 LYS n 1 93 GLU n 1 94 ALA n 1 95 GLN n 1 96 PRO n 1 97 PHE n 1 98 LYS n 1 99 ILE n 1 100 GLU n 1 101 ILE n 1 102 ARG n 1 103 ARG n 1 104 ASP n 1 105 TYR n 1 106 LEU n 1 107 ASP n 1 108 ASP n 1 109 PRO n 1 110 ARG n 1 111 THR n 1 112 ALA n 1 113 LEU n 1 114 ALA n 1 115 LYS n 1 116 SER n 1 117 ARG n 1 118 GLU n 1 119 MSE n 1 120 GLU n 1 121 LEU n 1 122 LEU n 1 123 VAL n 1 124 LYS n 1 125 GLU n 1 126 MSE n 1 127 ARG n 1 128 ILE n 1 129 GLN n 1 130 ALA n 1 131 ALA n 1 132 ASP n 1 133 ARG n 1 134 ILE n 1 135 LEU n 1 136 GLN n 1 137 SER n 1 138 MSE n 1 139 ALA n 1 140 SER n 1 141 THR n 1 142 GLU n 1 143 VAL n 1 144 ASN n 1 145 LEU n 1 146 GLU n 1 147 HIS n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Shewanella _entity_src_gen.pdbx_gene_src_gene SO_1173 _entity_src_gen.gene_src_species 'Shewanella oneidensis' _entity_src_gen.gene_src_strain MR-1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shewanella oneidensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 211586 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector BL21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8EHP5_SHEON _struct_ref.pdbx_db_accession Q8EHP5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GFKLQRSYQIPEQLNQLSLSSSDEYSELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEYELIY FVEFAVALPGKEAQPFKIEIRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMASTEVN ; _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2R76 A 2 ? 144 ? Q8EHP5 22 ? 164 ? 22 164 2 1 2R76 B 2 ? 144 ? Q8EHP5 22 ? 164 ? 22 164 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2R76 MSE A 1 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 21 1 1 2R76 LYS A 27 ? UNP Q8EHP5 SER 47 'SEE REMARK 999' 47 2 1 2R76 LEU A 145 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 165 3 1 2R76 GLU A 146 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 166 4 1 2R76 HIS A 147 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 167 5 1 2R76 HIS A 148 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 168 6 1 2R76 HIS A 149 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 169 7 1 2R76 HIS A 150 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 170 8 1 2R76 HIS A 151 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 171 9 1 2R76 HIS A 152 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 172 10 2 2R76 MSE B 1 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 21 11 2 2R76 LYS B 27 ? UNP Q8EHP5 SER 47 'SEE REMARK 999' 47 12 2 2R76 LEU B 145 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 165 13 2 2R76 GLU B 146 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 166 14 2 2R76 HIS B 147 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 167 15 2 2R76 HIS B 148 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 168 16 2 2R76 HIS B 149 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 169 17 2 2R76 HIS B 150 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 170 18 2 2R76 HIS B 151 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 171 19 2 2R76 HIS B 152 ? UNP Q8EHP5 ? ? 'EXPRESSION TAG' 172 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2R76 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.04 _exptl_crystal.density_percent_sol 59.58 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'MICROBATCH UNDER OIL' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.pdbx_details ;Protein solution: 10 mM Tris-HCl pH 7.5, 100 mM NaCl, 5 mM DTT. Reservoir solution: 0.1 M Sodium acetate pH 4.6, 15% PEG 20000, MICROBATCH UNDER OIL, temperature 291K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2007-08-29 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97893 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97893 # _reflns.entry_id 2R76 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 30.00 _reflns.d_resolution_high 2.6 _reflns.number_obs 25394 _reflns.number_all 25394 _reflns.percent_possible_obs 98.6 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rsym_value 0.063 _reflns.pdbx_netI_over_sigmaI 40.72 _reflns.B_iso_Wilson_estimate 44.3 _reflns.pdbx_redundancy 14.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 99.0 _reflns_shell.Rmerge_I_obs 0.424 _reflns_shell.pdbx_Rsym_value 0.364 _reflns_shell.meanI_over_sigI_obs 5.2 _reflns_shell.pdbx_redundancy 13.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2561 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2R76 _refine.ls_number_reflns_obs 23459 _refine.ls_number_reflns_all 25394 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 423135.09 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.00 _refine.ls_d_res_high 2.60 _refine.ls_percent_reflns_obs 91.1 _refine.ls_R_factor_obs 0.247 _refine.ls_R_factor_all 0.248 _refine.ls_R_factor_R_work 0.247 _refine.ls_R_factor_R_free 0.293 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.4 _refine.ls_number_reflns_R_free 2196 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 55.7 _refine.aniso_B[1][1] 10.88 _refine.aniso_B[2][2] 10.88 _refine.aniso_B[3][3] -21.76 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.35 _refine.solvent_model_param_bsol 42.0468 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2R76 _refine_analyze.Luzzati_coordinate_error_obs 0.37 _refine_analyze.Luzzati_sigma_a_obs 0.36 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.48 _refine_analyze.Luzzati_sigma_a_free 0.53 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2103 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2141 _refine_hist.d_res_high 2.60 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.8 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.84 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.d_res_high 2.60 _refine_ls_shell.d_res_low 2.69 _refine_ls_shell.number_reflns_R_work 1574 _refine_ls_shell.R_factor_R_work 0.281 _refine_ls_shell.percent_reflns_obs 66.8 _refine_ls_shell.R_factor_R_free 0.367 _refine_ls_shell.R_factor_R_free_error 0.029 _refine_ls_shell.percent_reflns_R_free 9.3 _refine_ls_shell.number_reflns_R_free 162 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1574 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2R76 _struct.title ;Crystal structure of the rare lipoprotein B (SO_1173) from Shewanella oneidensis, Northeast Structural Genomics Consortium Target SoR91A ; _struct.pdbx_descriptor 'Rare lipoprotein B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2R76 _struct_keywords.pdbx_keywords LIPOPROTEIN _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Lipoprotein ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 27 ? ASN A 40 ? LYS A 47 ASN A 60 1 ? 14 HELX_P HELX_P2 2 THR A 111 ? GLU A 146 ? THR A 131 GLU A 166 1 ? 36 HELX_P HELX_P3 3 LYS B 27 ? LEU B 39 ? LYS B 47 LEU B 59 1 ? 13 HELX_P HELX_P4 4 LEU B 113 ? ASN B 144 ? LEU B 133 ASN B 164 1 ? 32 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLU 118 C ? ? ? 1_555 A MSE 119 N ? ? A GLU 138 A MSE 139 1_555 ? ? ? ? ? ? ? 1.323 ? covale2 covale ? ? A MSE 119 C ? ? ? 1_555 A GLU 120 N ? ? A MSE 139 A GLU 140 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A GLU 125 C ? ? ? 1_555 A MSE 126 N ? ? A GLU 145 A MSE 146 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale ? ? A MSE 126 C ? ? ? 1_555 A ARG 127 N ? ? A MSE 146 A ARG 147 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale ? ? A SER 137 C ? ? ? 1_555 A MSE 138 N ? ? A SER 157 A MSE 158 1_555 ? ? ? ? ? ? ? 1.325 ? covale6 covale ? ? A MSE 138 C ? ? ? 1_555 A ALA 139 N ? ? A MSE 158 A ALA 159 1_555 ? ? ? ? ? ? ? 1.327 ? covale7 covale ? ? B GLU 118 C ? ? ? 1_555 B MSE 119 N ? ? B GLU 138 B MSE 139 1_555 ? ? ? ? ? ? ? 1.331 ? covale8 covale ? ? B MSE 119 C ? ? ? 1_555 B GLU 120 N ? ? B MSE 139 B GLU 140 1_555 ? ? ? ? ? ? ? 1.324 ? covale9 covale ? ? B GLU 125 C ? ? ? 1_555 B MSE 126 N ? ? B GLU 145 B MSE 146 1_555 ? ? ? ? ? ? ? 1.328 ? covale10 covale ? ? B MSE 126 C ? ? ? 1_555 B ARG 127 N ? ? B MSE 146 B ARG 147 1_555 ? ? ? ? ? ? ? 1.328 ? covale11 covale ? ? B SER 137 C ? ? ? 1_555 B MSE 138 N ? ? B SER 157 B MSE 158 1_555 ? ? ? ? ? ? ? 1.325 ? covale12 covale ? ? B MSE 138 C ? ? ? 1_555 B ALA 139 N ? ? B MSE 158 B ALA 159 1_555 ? ? ? ? ? ? ? 1.331 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel A 7 8 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 43 ? ILE A 44 ? LYS A 63 ILE A 64 A 2 GLN A 17 ? SER A 22 ? GLN A 37 SER A 42 A 3 VAL A 53 ? LEU A 68 ? VAL A 73 LEU A 88 A 4 VAL A 74 ? ALA A 88 ? VAL A 94 ALA A 108 A 5 GLN A 95 ? LEU A 106 ? GLN A 115 LEU A 126 A 6 VAL B 53 ? LEU B 68 ? VAL B 73 LEU B 88 A 7 GLN B 17 ? SER B 22 ? GLN B 37 SER B 42 A 8 LYS B 43 ? ILE B 44 ? LYS B 63 ILE B 64 B 1 LYS A 43 ? ILE A 44 ? LYS A 63 ILE A 64 B 2 GLN A 17 ? SER A 22 ? GLN A 37 SER A 42 B 3 VAL A 53 ? LEU A 68 ? VAL A 73 LEU A 88 B 4 VAL A 74 ? ALA A 88 ? VAL A 94 ALA A 108 B 5 GLN A 95 ? LEU A 106 ? GLN A 115 LEU A 126 B 6 VAL B 53 ? LEU B 68 ? VAL B 73 LEU B 88 B 7 VAL B 74 ? ALA B 88 ? VAL B 94 ALA B 108 B 8 GLN B 95 ? LEU B 106 ? GLN B 115 LEU B 126 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 43 ? O LYS A 63 N LEU A 18 ? N LEU A 38 A 2 3 N SER A 21 ? N SER A 41 O LEU A 56 ? O LEU A 76 A 3 4 N LEU A 66 ? N LEU A 86 O GLU A 76 ? O GLU A 96 A 4 5 N LEU A 79 ? N LEU A 99 O ARG A 103 ? O ARG A 123 A 5 6 N GLU A 100 ? N GLU A 120 O ARG B 63 ? O ARG B 83 A 6 7 O LEU B 56 ? O LEU B 76 N SER B 21 ? N SER B 41 A 7 8 N LEU B 18 ? N LEU B 38 O LYS B 43 ? O LYS B 63 B 1 2 O LYS A 43 ? O LYS A 63 N LEU A 18 ? N LEU A 38 B 2 3 N SER A 21 ? N SER A 41 O LEU A 56 ? O LEU A 76 B 3 4 N LEU A 66 ? N LEU A 86 O GLU A 76 ? O GLU A 96 B 4 5 N LEU A 79 ? N LEU A 99 O ARG A 103 ? O ARG A 123 B 5 6 N GLU A 100 ? N GLU A 120 O ARG B 63 ? O ARG B 83 B 6 7 N SER B 60 ? N SER B 80 O PHE B 82 ? O PHE B 102 B 7 8 N LEU B 79 ? N LEU B 99 O ARG B 103 ? O ARG B 123 # _database_PDB_matrix.entry_id 2R76 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2R76 _atom_sites.fract_transf_matrix[1][1] 0.011352 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011352 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008910 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 21 ? ? ? A . n A 1 2 GLY 2 22 ? ? ? A . n A 1 3 PHE 3 23 ? ? ? A . n A 1 4 LYS 4 24 ? ? ? A . n A 1 5 LEU 5 25 ? ? ? A . n A 1 6 GLN 6 26 ? ? ? A . n A 1 7 ARG 7 27 ? ? ? A . n A 1 8 SER 8 28 ? ? ? A . n A 1 9 TYR 9 29 ? ? ? A . n A 1 10 GLN 10 30 ? ? ? A . n A 1 11 ILE 11 31 ? ? ? A . n A 1 12 PRO 12 32 ? ? ? A . n A 1 13 GLU 13 33 ? ? ? A . n A 1 14 GLN 14 34 ? ? ? A . n A 1 15 LEU 15 35 ? ? ? A . n A 1 16 ASN 16 36 36 ASN ASN A . n A 1 17 GLN 17 37 37 GLN GLN A . n A 1 18 LEU 18 38 38 LEU LEU A . n A 1 19 SER 19 39 39 SER SER A . n A 1 20 LEU 20 40 40 LEU LEU A . n A 1 21 SER 21 41 41 SER SER A . n A 1 22 SER 22 42 42 SER SER A . n A 1 23 SER 23 43 43 SER SER A . n A 1 24 ASP 24 44 44 ASP ASP A . n A 1 25 GLU 25 45 45 GLU GLU A . n A 1 26 TYR 26 46 46 TYR TYR A . n A 1 27 LYS 27 47 47 LYS LYS A . n A 1 28 GLU 28 48 48 GLU GLU A . n A 1 29 LEU 29 49 49 LEU LEU A . n A 1 30 THR 30 50 50 THR THR A . n A 1 31 ARG 31 51 51 ARG ARG A . n A 1 32 LEU 32 52 52 LEU LEU A . n A 1 33 VAL 33 53 53 VAL VAL A . n A 1 34 ARG 34 54 54 ARG ARG A . n A 1 35 GLU 35 55 55 GLU GLU A . n A 1 36 ARG 36 56 56 ARG ARG A . n A 1 37 LEU 37 57 57 LEU LEU A . n A 1 38 ARG 38 58 58 ARG ARG A . n A 1 39 LEU 39 59 59 LEU LEU A . n A 1 40 ASN 40 60 60 ASN ASN A . n A 1 41 ASN 41 61 61 ASN ASN A . n A 1 42 VAL 42 62 62 VAL VAL A . n A 1 43 LYS 43 63 63 LYS LYS A . n A 1 44 ILE 44 64 64 ILE ILE A . n A 1 45 VAL 45 65 65 VAL VAL A . n A 1 46 ASP 46 66 66 ASP ASP A . n A 1 47 ALA 47 67 67 ALA ALA A . n A 1 48 ALA 48 68 68 ALA ALA A . n A 1 49 ASN 49 69 69 ASN ASN A . n A 1 50 ASP 50 70 70 ASP ASP A . n A 1 51 VAL 51 71 71 VAL VAL A . n A 1 52 PRO 52 72 72 PRO PRO A . n A 1 53 VAL 53 73 73 VAL VAL A . n A 1 54 LEU 54 74 74 LEU LEU A . n A 1 55 ARG 55 75 75 ARG ARG A . n A 1 56 LEU 56 76 76 LEU LEU A . n A 1 57 ILE 57 77 77 ILE ILE A . n A 1 58 THR 58 78 78 THR THR A . n A 1 59 ASP 59 79 79 ASP ASP A . n A 1 60 SER 60 80 80 SER SER A . n A 1 61 LEU 61 81 81 LEU LEU A . n A 1 62 GLU 62 82 82 GLU GLU A . n A 1 63 ARG 63 83 83 ARG ARG A . n A 1 64 SER 64 84 84 SER SER A . n A 1 65 THR 65 85 85 THR THR A . n A 1 66 LEU 66 86 86 LEU LEU A . n A 1 67 SER 67 87 87 SER SER A . n A 1 68 LEU 68 88 88 LEU LEU A . n A 1 69 TYR 69 89 89 TYR TYR A . n A 1 70 PRO 70 90 90 PRO PRO A . n A 1 71 THR 71 91 91 THR THR A . n A 1 72 GLY 72 92 92 GLY GLY A . n A 1 73 ASN 73 93 93 ASN ASN A . n A 1 74 VAL 74 94 94 VAL VAL A . n A 1 75 ALA 75 95 95 ALA ALA A . n A 1 76 GLU 76 96 96 GLU GLU A . n A 1 77 TYR 77 97 97 TYR TYR A . n A 1 78 GLU 78 98 98 GLU GLU A . n A 1 79 LEU 79 99 99 LEU LEU A . n A 1 80 ILE 80 100 100 ILE ILE A . n A 1 81 TYR 81 101 101 TYR TYR A . n A 1 82 PHE 82 102 102 PHE PHE A . n A 1 83 VAL 83 103 103 VAL VAL A . n A 1 84 GLU 84 104 104 GLU GLU A . n A 1 85 PHE 85 105 105 PHE PHE A . n A 1 86 ALA 86 106 106 ALA ALA A . n A 1 87 VAL 87 107 107 VAL VAL A . n A 1 88 ALA 88 108 108 ALA ALA A . n A 1 89 LEU 89 109 109 LEU LEU A . n A 1 90 PRO 90 110 110 PRO PRO A . n A 1 91 GLY 91 111 111 GLY GLY A . n A 1 92 LYS 92 112 112 LYS LYS A . n A 1 93 GLU 93 113 113 GLU GLU A . n A 1 94 ALA 94 114 114 ALA ALA A . n A 1 95 GLN 95 115 115 GLN GLN A . n A 1 96 PRO 96 116 116 PRO PRO A . n A 1 97 PHE 97 117 117 PHE PHE A . n A 1 98 LYS 98 118 118 LYS LYS A . n A 1 99 ILE 99 119 119 ILE ILE A . n A 1 100 GLU 100 120 120 GLU GLU A . n A 1 101 ILE 101 121 121 ILE ILE A . n A 1 102 ARG 102 122 122 ARG ARG A . n A 1 103 ARG 103 123 123 ARG ARG A . n A 1 104 ASP 104 124 124 ASP ASP A . n A 1 105 TYR 105 125 125 TYR TYR A . n A 1 106 LEU 106 126 126 LEU LEU A . n A 1 107 ASP 107 127 127 ASP ASP A . n A 1 108 ASP 108 128 128 ASP ASP A . n A 1 109 PRO 109 129 129 PRO PRO A . n A 1 110 ARG 110 130 130 ARG ARG A . n A 1 111 THR 111 131 131 THR THR A . n A 1 112 ALA 112 132 132 ALA ALA A . n A 1 113 LEU 113 133 133 LEU LEU A . n A 1 114 ALA 114 134 134 ALA ALA A . n A 1 115 LYS 115 135 135 LYS LYS A . n A 1 116 SER 116 136 136 SER SER A . n A 1 117 ARG 117 137 137 ARG ARG A . n A 1 118 GLU 118 138 138 GLU GLU A . n A 1 119 MSE 119 139 139 MSE MSE A . n A 1 120 GLU 120 140 140 GLU GLU A . n A 1 121 LEU 121 141 141 LEU LEU A . n A 1 122 LEU 122 142 142 LEU LEU A . n A 1 123 VAL 123 143 143 VAL VAL A . n A 1 124 LYS 124 144 144 LYS LYS A . n A 1 125 GLU 125 145 145 GLU GLU A . n A 1 126 MSE 126 146 146 MSE MSE A . n A 1 127 ARG 127 147 147 ARG ARG A . n A 1 128 ILE 128 148 148 ILE ILE A . n A 1 129 GLN 129 149 149 GLN GLN A . n A 1 130 ALA 130 150 150 ALA ALA A . n A 1 131 ALA 131 151 151 ALA ALA A . n A 1 132 ASP 132 152 152 ASP ASP A . n A 1 133 ARG 133 153 153 ARG ARG A . n A 1 134 ILE 134 154 154 ILE ILE A . n A 1 135 LEU 135 155 155 LEU LEU A . n A 1 136 GLN 136 156 156 GLN GLN A . n A 1 137 SER 137 157 157 SER SER A . n A 1 138 MSE 138 158 158 MSE MSE A . n A 1 139 ALA 139 159 159 ALA ALA A . n A 1 140 SER 140 160 160 SER SER A . n A 1 141 THR 141 161 161 THR THR A . n A 1 142 GLU 142 162 162 GLU GLU A . n A 1 143 VAL 143 163 163 VAL VAL A . n A 1 144 ASN 144 164 164 ASN ASN A . n A 1 145 LEU 145 165 165 LEU LEU A . n A 1 146 GLU 146 166 166 GLU GLU A . n A 1 147 HIS 147 167 167 HIS HIS A . n A 1 148 HIS 148 168 ? ? ? A . n A 1 149 HIS 149 169 ? ? ? A . n A 1 150 HIS 150 170 ? ? ? A . n A 1 151 HIS 151 171 ? ? ? A . n A 1 152 HIS 152 172 ? ? ? A . n B 1 1 MSE 1 21 ? ? ? B . n B 1 2 GLY 2 22 ? ? ? B . n B 1 3 PHE 3 23 ? ? ? B . n B 1 4 LYS 4 24 ? ? ? B . n B 1 5 LEU 5 25 ? ? ? B . n B 1 6 GLN 6 26 ? ? ? B . n B 1 7 ARG 7 27 ? ? ? B . n B 1 8 SER 8 28 ? ? ? B . n B 1 9 TYR 9 29 ? ? ? B . n B 1 10 GLN 10 30 ? ? ? B . n B 1 11 ILE 11 31 ? ? ? B . n B 1 12 PRO 12 32 ? ? ? B . n B 1 13 GLU 13 33 ? ? ? B . n B 1 14 GLN 14 34 ? ? ? B . n B 1 15 LEU 15 35 ? ? ? B . n B 1 16 ASN 16 36 36 ASN ASN B . n B 1 17 GLN 17 37 37 GLN GLN B . n B 1 18 LEU 18 38 38 LEU LEU B . n B 1 19 SER 19 39 39 SER SER B . n B 1 20 LEU 20 40 40 LEU LEU B . n B 1 21 SER 21 41 41 SER SER B . n B 1 22 SER 22 42 42 SER SER B . n B 1 23 SER 23 43 43 SER SER B . n B 1 24 ASP 24 44 44 ASP ASP B . n B 1 25 GLU 25 45 45 GLU GLU B . n B 1 26 TYR 26 46 46 TYR TYR B . n B 1 27 LYS 27 47 47 LYS LYS B . n B 1 28 GLU 28 48 48 GLU GLU B . n B 1 29 LEU 29 49 49 LEU LEU B . n B 1 30 THR 30 50 50 THR THR B . n B 1 31 ARG 31 51 51 ARG ARG B . n B 1 32 LEU 32 52 52 LEU LEU B . n B 1 33 VAL 33 53 53 VAL VAL B . n B 1 34 ARG 34 54 54 ARG ARG B . n B 1 35 GLU 35 55 55 GLU GLU B . n B 1 36 ARG 36 56 56 ARG ARG B . n B 1 37 LEU 37 57 57 LEU LEU B . n B 1 38 ARG 38 58 58 ARG ARG B . n B 1 39 LEU 39 59 59 LEU LEU B . n B 1 40 ASN 40 60 60 ASN ASN B . n B 1 41 ASN 41 61 61 ASN ASN B . n B 1 42 VAL 42 62 62 VAL VAL B . n B 1 43 LYS 43 63 63 LYS LYS B . n B 1 44 ILE 44 64 64 ILE ILE B . n B 1 45 VAL 45 65 65 VAL VAL B . n B 1 46 ASP 46 66 66 ASP ASP B . n B 1 47 ALA 47 67 67 ALA ALA B . n B 1 48 ALA 48 68 68 ALA ALA B . n B 1 49 ASN 49 69 69 ASN ASN B . n B 1 50 ASP 50 70 70 ASP ASP B . n B 1 51 VAL 51 71 71 VAL VAL B . n B 1 52 PRO 52 72 72 PRO PRO B . n B 1 53 VAL 53 73 73 VAL VAL B . n B 1 54 LEU 54 74 74 LEU LEU B . n B 1 55 ARG 55 75 75 ARG ARG B . n B 1 56 LEU 56 76 76 LEU LEU B . n B 1 57 ILE 57 77 77 ILE ILE B . n B 1 58 THR 58 78 78 THR THR B . n B 1 59 ASP 59 79 79 ASP ASP B . n B 1 60 SER 60 80 80 SER SER B . n B 1 61 LEU 61 81 81 LEU LEU B . n B 1 62 GLU 62 82 82 GLU GLU B . n B 1 63 ARG 63 83 83 ARG ARG B . n B 1 64 SER 64 84 84 SER SER B . n B 1 65 THR 65 85 85 THR THR B . n B 1 66 LEU 66 86 86 LEU LEU B . n B 1 67 SER 67 87 87 SER SER B . n B 1 68 LEU 68 88 88 LEU LEU B . n B 1 69 TYR 69 89 89 TYR TYR B . n B 1 70 PRO 70 90 90 PRO PRO B . n B 1 71 THR 71 91 91 THR THR B . n B 1 72 GLY 72 92 92 GLY GLY B . n B 1 73 ASN 73 93 93 ASN ASN B . n B 1 74 VAL 74 94 94 VAL VAL B . n B 1 75 ALA 75 95 95 ALA ALA B . n B 1 76 GLU 76 96 96 GLU GLU B . n B 1 77 TYR 77 97 97 TYR TYR B . n B 1 78 GLU 78 98 98 GLU GLU B . n B 1 79 LEU 79 99 99 LEU LEU B . n B 1 80 ILE 80 100 100 ILE ILE B . n B 1 81 TYR 81 101 101 TYR TYR B . n B 1 82 PHE 82 102 102 PHE PHE B . n B 1 83 VAL 83 103 103 VAL VAL B . n B 1 84 GLU 84 104 104 GLU GLU B . n B 1 85 PHE 85 105 105 PHE PHE B . n B 1 86 ALA 86 106 106 ALA ALA B . n B 1 87 VAL 87 107 107 VAL VAL B . n B 1 88 ALA 88 108 108 ALA ALA B . n B 1 89 LEU 89 109 109 LEU LEU B . n B 1 90 PRO 90 110 110 PRO PRO B . n B 1 91 GLY 91 111 111 GLY GLY B . n B 1 92 LYS 92 112 112 LYS LYS B . n B 1 93 GLU 93 113 113 GLU GLU B . n B 1 94 ALA 94 114 114 ALA ALA B . n B 1 95 GLN 95 115 115 GLN GLN B . n B 1 96 PRO 96 116 116 PRO PRO B . n B 1 97 PHE 97 117 117 PHE PHE B . n B 1 98 LYS 98 118 118 LYS LYS B . n B 1 99 ILE 99 119 119 ILE ILE B . n B 1 100 GLU 100 120 120 GLU GLU B . n B 1 101 ILE 101 121 121 ILE ILE B . n B 1 102 ARG 102 122 122 ARG ARG B . n B 1 103 ARG 103 123 123 ARG ARG B . n B 1 104 ASP 104 124 124 ASP ASP B . n B 1 105 TYR 105 125 125 TYR TYR B . n B 1 106 LEU 106 126 126 LEU LEU B . n B 1 107 ASP 107 127 127 ASP ASP B . n B 1 108 ASP 108 128 128 ASP ASP B . n B 1 109 PRO 109 129 129 PRO PRO B . n B 1 110 ARG 110 130 130 ARG ARG B . n B 1 111 THR 111 131 131 THR THR B . n B 1 112 ALA 112 132 132 ALA ALA B . n B 1 113 LEU 113 133 133 LEU LEU B . n B 1 114 ALA 114 134 134 ALA ALA B . n B 1 115 LYS 115 135 135 LYS LYS B . n B 1 116 SER 116 136 136 SER SER B . n B 1 117 ARG 117 137 137 ARG ARG B . n B 1 118 GLU 118 138 138 GLU GLU B . n B 1 119 MSE 119 139 139 MSE MSE B . n B 1 120 GLU 120 140 140 GLU GLU B . n B 1 121 LEU 121 141 141 LEU LEU B . n B 1 122 LEU 122 142 142 LEU LEU B . n B 1 123 VAL 123 143 143 VAL VAL B . n B 1 124 LYS 124 144 144 LYS LYS B . n B 1 125 GLU 125 145 145 GLU GLU B . n B 1 126 MSE 126 146 146 MSE MSE B . n B 1 127 ARG 127 147 147 ARG ARG B . n B 1 128 ILE 128 148 148 ILE ILE B . n B 1 129 GLN 129 149 149 GLN GLN B . n B 1 130 ALA 130 150 150 ALA ALA B . n B 1 131 ALA 131 151 151 ALA ALA B . n B 1 132 ASP 132 152 152 ASP ASP B . n B 1 133 ARG 133 153 153 ARG ARG B . n B 1 134 ILE 134 154 154 ILE ILE B . n B 1 135 LEU 135 155 155 LEU LEU B . n B 1 136 GLN 136 156 156 GLN GLN B . n B 1 137 SER 137 157 157 SER SER B . n B 1 138 MSE 138 158 158 MSE MSE B . n B 1 139 ALA 139 159 159 ALA ALA B . n B 1 140 SER 140 160 160 SER SER B . n B 1 141 THR 141 161 161 THR THR B . n B 1 142 GLU 142 162 162 GLU GLU B . n B 1 143 VAL 143 163 163 VAL VAL B . n B 1 144 ASN 144 164 164 ASN ASN B . n B 1 145 LEU 145 165 ? ? ? B . n B 1 146 GLU 146 166 ? ? ? B . n B 1 147 HIS 147 167 ? ? ? B . n B 1 148 HIS 148 168 ? ? ? B . n B 1 149 HIS 149 169 ? ? ? B . n B 1 150 HIS 150 170 ? ? ? B . n B 1 151 HIS 151 171 ? ? ? B . n B 1 152 HIS 152 172 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 173 1 HOH HOH A . C 2 HOH 2 174 3 HOH HOH A . C 2 HOH 3 175 4 HOH HOH A . C 2 HOH 4 176 12 HOH HOH A . C 2 HOH 5 177 13 HOH HOH A . C 2 HOH 6 178 14 HOH HOH A . C 2 HOH 7 179 15 HOH HOH A . C 2 HOH 8 180 16 HOH HOH A . C 2 HOH 9 181 17 HOH HOH A . C 2 HOH 10 182 18 HOH HOH A . C 2 HOH 11 183 21 HOH HOH A . C 2 HOH 12 184 22 HOH HOH A . C 2 HOH 13 185 23 HOH HOH A . C 2 HOH 14 186 24 HOH HOH A . C 2 HOH 15 187 25 HOH HOH A . C 2 HOH 16 188 26 HOH HOH A . C 2 HOH 17 189 27 HOH HOH A . C 2 HOH 18 190 28 HOH HOH A . C 2 HOH 19 191 29 HOH HOH A . C 2 HOH 20 192 31 HOH HOH A . C 2 HOH 21 193 34 HOH HOH A . C 2 HOH 22 194 35 HOH HOH A . C 2 HOH 23 195 36 HOH HOH A . C 2 HOH 24 196 37 HOH HOH A . C 2 HOH 25 197 38 HOH HOH A . D 2 HOH 1 173 2 HOH HOH B . D 2 HOH 2 174 5 HOH HOH B . D 2 HOH 3 175 6 HOH HOH B . D 2 HOH 4 176 7 HOH HOH B . D 2 HOH 5 177 8 HOH HOH B . D 2 HOH 6 178 9 HOH HOH B . D 2 HOH 7 179 10 HOH HOH B . D 2 HOH 8 180 11 HOH HOH B . D 2 HOH 9 181 19 HOH HOH B . D 2 HOH 10 182 20 HOH HOH B . D 2 HOH 11 183 30 HOH HOH B . D 2 HOH 12 184 32 HOH HOH B . D 2 HOH 13 185 33 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 119 A MSE 139 ? MET SELENOMETHIONINE 2 A MSE 126 A MSE 146 ? MET SELENOMETHIONINE 3 A MSE 138 A MSE 158 ? MET SELENOMETHIONINE 4 B MSE 119 B MSE 139 ? MET SELENOMETHIONINE 5 B MSE 126 B MSE 146 ? MET SELENOMETHIONINE 6 B MSE 138 B MSE 158 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 software_defined_assembly PISA monomeric 1 3 software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1 A,C 3 1 B,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 3 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.2 ? 1 ADSC 'data collection' Quantum ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SnB phasing . ? 5 RESOLVE phasing . ? 6 # _pdbx_database_remark.id 999 _pdbx_database_remark.text ; SEQUENCE THE N-TERMINAL 21 AMINO ACIDS HAVE BEEN DELETED. SERINE-47 HAS BEEN MODELED AS LYSINE-47 IN THE STURCTURE BASED ON UNAMBIGUOUS ELECTRON DENSITY. THIS MUTATION MIGHT OCCUR DURING CLONING. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 44 ? ? -158.90 79.83 2 1 ALA A 67 ? ? 34.68 50.89 3 1 ARG A 130 ? ? -52.91 -179.29 4 1 GLU A 166 ? ? -65.03 2.95 5 1 LEU B 59 ? ? -58.50 -7.84 6 1 TYR B 89 ? ? -49.30 152.87 7 1 ALA B 95 ? ? -68.20 -84.67 8 1 ARG B 130 ? ? -58.73 -170.65 9 1 ALA B 132 ? ? -69.83 20.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 21 ? A MSE 1 2 1 Y 1 A GLY 22 ? A GLY 2 3 1 Y 1 A PHE 23 ? A PHE 3 4 1 Y 1 A LYS 24 ? A LYS 4 5 1 Y 1 A LEU 25 ? A LEU 5 6 1 Y 1 A GLN 26 ? A GLN 6 7 1 Y 1 A ARG 27 ? A ARG 7 8 1 Y 1 A SER 28 ? A SER 8 9 1 Y 1 A TYR 29 ? A TYR 9 10 1 Y 1 A GLN 30 ? A GLN 10 11 1 Y 1 A ILE 31 ? A ILE 11 12 1 Y 1 A PRO 32 ? A PRO 12 13 1 Y 1 A GLU 33 ? A GLU 13 14 1 Y 1 A GLN 34 ? A GLN 14 15 1 Y 1 A LEU 35 ? A LEU 15 16 1 Y 1 A HIS 168 ? A HIS 148 17 1 Y 1 A HIS 169 ? A HIS 149 18 1 Y 1 A HIS 170 ? A HIS 150 19 1 Y 1 A HIS 171 ? A HIS 151 20 1 Y 1 A HIS 172 ? A HIS 152 21 1 Y 1 B MSE 21 ? B MSE 1 22 1 Y 1 B GLY 22 ? B GLY 2 23 1 Y 1 B PHE 23 ? B PHE 3 24 1 Y 1 B LYS 24 ? B LYS 4 25 1 Y 1 B LEU 25 ? B LEU 5 26 1 Y 1 B GLN 26 ? B GLN 6 27 1 Y 1 B ARG 27 ? B ARG 7 28 1 Y 1 B SER 28 ? B SER 8 29 1 Y 1 B TYR 29 ? B TYR 9 30 1 Y 1 B GLN 30 ? B GLN 10 31 1 Y 1 B ILE 31 ? B ILE 11 32 1 Y 1 B PRO 32 ? B PRO 12 33 1 Y 1 B GLU 33 ? B GLU 13 34 1 Y 1 B GLN 34 ? B GLN 14 35 1 Y 1 B LEU 35 ? B LEU 15 36 1 Y 1 B LEU 165 ? B LEU 145 37 1 Y 1 B GLU 166 ? B GLU 146 38 1 Y 1 B HIS 167 ? B HIS 147 39 1 Y 1 B HIS 168 ? B HIS 148 40 1 Y 1 B HIS 169 ? B HIS 149 41 1 Y 1 B HIS 170 ? B HIS 150 42 1 Y 1 B HIS 171 ? B HIS 151 43 1 Y 1 B HIS 172 ? B HIS 152 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #