data_2RG5 # _entry.id 2RG5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2RG5 RCSB RCSB044818 WWPDB D_1000044818 # _pdbx_database_status.entry_id 2RG5 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-10-02 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # _audit_author.name 'Sack, J.S.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title ;Design, Synthesis, and Anti-inflammatory Properties of Orally Active 4-(Phenylamino)-pyrrolo[2,1-f][1,2,4]triazine p38alpha Mitogen-Activated Protein Kinase Inhibitors ; _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 51 _citation.page_first 4 _citation.page_last 16 _citation.year 2008 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18072718 _citation.pdbx_database_id_DOI 10.1021/jm7009414 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Hynes, J.' 1 primary 'Dyckman, A.J.' 2 primary 'Lin, S.' 3 primary 'Wrobleski, S.T.' 4 primary 'Wu, H.' 5 primary 'Gillooly, K.M.' 6 primary 'Kanner, S.B.' 7 primary 'Lonial, H.' 8 primary 'Loo, D.' 9 primary 'McIntyre, K.W.' 10 primary 'Pitt, S.' 11 primary 'Shen, D.R.' 12 primary 'Shuster, D.J.' 13 primary 'Yang, X.' 14 primary 'Zhang, R.' 15 primary 'Behnia, K.' 16 primary 'Zhang, H.' 17 primary 'Marathe, P.H.' 18 primary 'Doweyko, A.M.' 19 primary 'Tokarski, J.S.' 20 primary 'Sack, J.S.' 21 primary 'Pokross, M.' 22 primary 'Kiefer, S.E.' 23 primary 'Newitt, J.A.' 24 primary 'Barrish, J.C.' 25 primary 'Dodd, J.' 26 primary 'Schieven, G.L.' 27 primary 'Leftheris, K.' 28 # _cell.entry_id 2RG5 _cell.length_a 67.721 _cell.length_b 71.866 _cell.length_c 79.529 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2RG5 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitogen-activated protein kinase 14' 42105.004 1 2.7.11.24 ? ? ? 2 non-polymer syn 'N-ethyl-4-{[5-(methoxycarbamoyl)-2-methylphenyl]amino}-5-methylpyrrolo[2,1-f][1,2,4]triazine-6-carboxamide' 382.416 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Mitogen-activated protein kinase p38 alpha; MAP kinase p38 alpha; Cytokine suppressive anti-inflammatory drug-binding protein; CSAID-binding protein; CSBP; MAX-interacting protein 2; MAP kinase MXI2; SAPK2A ; # _entity_name_sys.entity_id 1 _entity_name_sys.name E.C.2.7.11.24 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRL LKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPS NLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKL ILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDP DDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRL LKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPS NLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKL ILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDP DDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 GLN n 1 10 GLU n 1 11 ARG n 1 12 PRO n 1 13 THR n 1 14 PHE n 1 15 TYR n 1 16 ARG n 1 17 GLN n 1 18 GLU n 1 19 LEU n 1 20 ASN n 1 21 LYS n 1 22 THR n 1 23 ILE n 1 24 TRP n 1 25 GLU n 1 26 VAL n 1 27 PRO n 1 28 GLU n 1 29 ARG n 1 30 TYR n 1 31 GLN n 1 32 ASN n 1 33 LEU n 1 34 SER n 1 35 PRO n 1 36 VAL n 1 37 GLY n 1 38 SER n 1 39 GLY n 1 40 ALA n 1 41 TYR n 1 42 GLY n 1 43 SER n 1 44 VAL n 1 45 CYS n 1 46 ALA n 1 47 ALA n 1 48 PHE n 1 49 ASP n 1 50 THR n 1 51 LYS n 1 52 THR n 1 53 GLY n 1 54 LEU n 1 55 ARG n 1 56 VAL n 1 57 ALA n 1 58 VAL n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 SER n 1 63 ARG n 1 64 PRO n 1 65 PHE n 1 66 GLN n 1 67 SER n 1 68 ILE n 1 69 ILE n 1 70 HIS n 1 71 ALA n 1 72 LYS n 1 73 ARG n 1 74 THR n 1 75 TYR n 1 76 ARG n 1 77 GLU n 1 78 LEU n 1 79 ARG n 1 80 LEU n 1 81 LEU n 1 82 LYS n 1 83 HIS n 1 84 MET n 1 85 LYS n 1 86 HIS n 1 87 GLU n 1 88 ASN n 1 89 VAL n 1 90 ILE n 1 91 GLY n 1 92 LEU n 1 93 LEU n 1 94 ASP n 1 95 VAL n 1 96 PHE n 1 97 THR n 1 98 PRO n 1 99 ALA n 1 100 ARG n 1 101 SER n 1 102 LEU n 1 103 GLU n 1 104 GLU n 1 105 PHE n 1 106 ASN n 1 107 ASP n 1 108 VAL n 1 109 TYR n 1 110 LEU n 1 111 VAL n 1 112 THR n 1 113 HIS n 1 114 LEU n 1 115 MET n 1 116 GLY n 1 117 ALA n 1 118 ASP n 1 119 LEU n 1 120 ASN n 1 121 ASN n 1 122 ILE n 1 123 VAL n 1 124 LYS n 1 125 CYS n 1 126 GLN n 1 127 LYS n 1 128 LEU n 1 129 THR n 1 130 ASP n 1 131 ASP n 1 132 HIS n 1 133 VAL n 1 134 GLN n 1 135 PHE n 1 136 LEU n 1 137 ILE n 1 138 TYR n 1 139 GLN n 1 140 ILE n 1 141 LEU n 1 142 ARG n 1 143 GLY n 1 144 LEU n 1 145 LYS n 1 146 TYR n 1 147 ILE n 1 148 HIS n 1 149 SER n 1 150 ALA n 1 151 ASP n 1 152 ILE n 1 153 ILE n 1 154 HIS n 1 155 ARG n 1 156 ASP n 1 157 LEU n 1 158 LYS n 1 159 PRO n 1 160 SER n 1 161 ASN n 1 162 LEU n 1 163 ALA n 1 164 VAL n 1 165 ASN n 1 166 GLU n 1 167 ASP n 1 168 CYS n 1 169 GLU n 1 170 LEU n 1 171 LYS n 1 172 ILE n 1 173 LEU n 1 174 ASP n 1 175 PHE n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 ARG n 1 180 HIS n 1 181 THR n 1 182 ASP n 1 183 ASP n 1 184 GLU n 1 185 MET n 1 186 THR n 1 187 GLY n 1 188 TYR n 1 189 VAL n 1 190 ALA n 1 191 THR n 1 192 ARG n 1 193 TRP n 1 194 TYR n 1 195 ARG n 1 196 ALA n 1 197 PRO n 1 198 GLU n 1 199 ILE n 1 200 MET n 1 201 LEU n 1 202 ASN n 1 203 TRP n 1 204 MET n 1 205 HIS n 1 206 TYR n 1 207 ASN n 1 208 GLN n 1 209 THR n 1 210 VAL n 1 211 ASP n 1 212 ILE n 1 213 TRP n 1 214 SER n 1 215 VAL n 1 216 GLY n 1 217 CYS n 1 218 ILE n 1 219 MET n 1 220 ALA n 1 221 GLU n 1 222 LEU n 1 223 LEU n 1 224 THR n 1 225 GLY n 1 226 ARG n 1 227 THR n 1 228 LEU n 1 229 PHE n 1 230 PRO n 1 231 GLY n 1 232 THR n 1 233 ASP n 1 234 HIS n 1 235 ILE n 1 236 ASP n 1 237 GLN n 1 238 LEU n 1 239 LYS n 1 240 LEU n 1 241 ILE n 1 242 LEU n 1 243 ARG n 1 244 LEU n 1 245 VAL n 1 246 GLY n 1 247 THR n 1 248 PRO n 1 249 GLY n 1 250 ALA n 1 251 GLU n 1 252 LEU n 1 253 LEU n 1 254 LYS n 1 255 LYS n 1 256 ILE n 1 257 SER n 1 258 SER n 1 259 GLU n 1 260 SER n 1 261 ALA n 1 262 ARG n 1 263 ASN n 1 264 TYR n 1 265 ILE n 1 266 GLN n 1 267 SER n 1 268 LEU n 1 269 THR n 1 270 GLN n 1 271 MET n 1 272 PRO n 1 273 LYS n 1 274 MET n 1 275 ASN n 1 276 PHE n 1 277 ALA n 1 278 ASN n 1 279 VAL n 1 280 PHE n 1 281 ILE n 1 282 GLY n 1 283 ALA n 1 284 ASN n 1 285 PRO n 1 286 LEU n 1 287 ALA n 1 288 VAL n 1 289 ASP n 1 290 LEU n 1 291 LEU n 1 292 GLU n 1 293 LYS n 1 294 MET n 1 295 LEU n 1 296 VAL n 1 297 LEU n 1 298 ASP n 1 299 SER n 1 300 ASP n 1 301 LYS n 1 302 ARG n 1 303 ILE n 1 304 THR n 1 305 ALA n 1 306 ALA n 1 307 GLN n 1 308 ALA n 1 309 LEU n 1 310 ALA n 1 311 HIS n 1 312 ALA n 1 313 TYR n 1 314 PHE n 1 315 ALA n 1 316 GLN n 1 317 TYR n 1 318 HIS n 1 319 ASP n 1 320 PRO n 1 321 ASP n 1 322 ASP n 1 323 GLU n 1 324 PRO n 1 325 VAL n 1 326 ALA n 1 327 ASP n 1 328 PRO n 1 329 TYR n 1 330 ASP n 1 331 GLN n 1 332 SER n 1 333 PHE n 1 334 GLU n 1 335 SER n 1 336 ARG n 1 337 ASP n 1 338 LEU n 1 339 LEU n 1 340 ILE n 1 341 ASP n 1 342 GLU n 1 343 TRP n 1 344 LYS n 1 345 SER n 1 346 LEU n 1 347 THR n 1 348 TYR n 1 349 ASP n 1 350 GLU n 1 351 VAL n 1 352 ILE n 1 353 SER n 1 354 PHE n 1 355 VAL n 1 356 PRO n 1 357 PRO n 1 358 PRO n 1 359 LEU n 1 360 ASP n 1 361 GLN n 1 362 GLU n 1 363 GLU n 1 364 MET n 1 365 GLU n 1 366 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'BL21 DE3' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code MK14_HUMAN _struct_ref.pdbx_db_accession Q16539 _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_seq_one_letter_code ;SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHE NVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED CELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGT PGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVAD PYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RG5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 366 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16539 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 360 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 360 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RG5 MET A 1 ? UNP Q16539 ? ? 'EXPRESSION TAG' -5 1 1 2RG5 ALA A 2 ? UNP Q16539 ? ? 'EXPRESSION TAG' -4 2 1 2RG5 HIS A 3 ? UNP Q16539 ? ? 'EXPRESSION TAG' -3 3 1 2RG5 HIS A 4 ? UNP Q16539 ? ? 'EXPRESSION TAG' -2 4 1 2RG5 HIS A 5 ? UNP Q16539 ? ? 'EXPRESSION TAG' -1 5 1 2RG5 HIS A 6 ? UNP Q16539 ? ? 'EXPRESSION TAG' 0 6 1 2RG5 HIS A 7 ? UNP Q16539 ? ? 'EXPRESSION TAG' 1 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 279 non-polymer . 'N-ethyl-4-{[5-(methoxycarbamoyl)-2-methylphenyl]amino}-5-methylpyrrolo[2,1-f][1,2,4]triazine-6-carboxamide' ? 'C19 H22 N6 O3' 382.416 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2RG5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_percent_sol 46.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2006-11-10 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_wavelength 1.0 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2RG5 _reflns.observed_criterion_sigma_I 0. _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 53.30 _reflns.d_resolution_high 2.40 _reflns.number_obs 14618 _reflns.number_all ? _reflns.percent_possible_obs 92.2 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 18.8 _reflns.B_iso_Wilson_estimate 49.401 _reflns.pdbx_redundancy 6.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.49 _reflns_shell.percent_possible_all 82.3 _reflns_shell.Rmerge_I_obs 0.37 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.6 _reflns_shell.pdbx_redundancy 5.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2RG5 _refine.ls_number_reflns_obs 14343 _refine.ls_number_reflns_all 14343 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 53.30 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 91.14 _refine.ls_R_factor_obs 0.2404 _refine.ls_R_factor_all 0.2404 _refine.ls_R_factor_R_work 0.2369 _refine.ls_R_factor_R_free 0.3053 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.95 _refine.ls_number_reflns_R_free 710 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 44.22 _refine.aniso_B[1][1] 13.69888069 _refine.aniso_B[2][2] 8.11861646 _refine.aniso_B[3][3] -21.81749715 _refine.aniso_B[1][2] 0.00000000 _refine.aniso_B[1][3] 0.00000000 _refine.aniso_B[2][3] 0.00000000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2702 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2768 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 53.30 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.006 ? 2.00 2811 'X-RAY DIFFRACTION' ? t_angle_deg 0.927 ? 2.00 3802 'X-RAY DIFFRACTION' ? t_dihedral_angle_d 26.291 ? 0.00 555 'X-RAY DIFFRACTION' ? t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes 0.006 ? 2.00 70 'X-RAY DIFFRACTION' ? t_gen_planes 0.012 ? 5.00 399 'X-RAY DIFFRACTION' ? t_it 1.371 ? 20.00 2811 'X-RAY DIFFRACTION' ? t_nbd 0.041 ? 5.00 84 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 9 _refine_ls_shell.d_res_high 2.40 _refine_ls_shell.d_res_low 2.54 _refine_ls_shell.number_reflns_R_work 1987 _refine_ls_shell.R_factor_R_work 0.2628 _refine_ls_shell.percent_reflns_obs 91.14 _refine_ls_shell.R_factor_R_free 0.3301 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.20 _refine_ls_shell.number_reflns_R_free 109 _refine_ls_shell.number_reflns_all 2096 _refine_ls_shell.R_factor_all 26.640000 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2RG5 _struct.title 'Phenylalanine pyrrolotriazine p38 alpha map kinase inhibitor compound 11B' _struct.pdbx_descriptor 'Mitogen-activated protein kinase 14 (E.C.2.7.11.24)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RG5 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'SERINE/THREONINE-PROTEIN KINASE, KINASE, TRANSFERASE, P38 MAP KINASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 67 ? MET A 84 ? SER A 61 MET A 78 1 ? 18 HELX_P HELX_P2 2 LEU A 119 ? VAL A 123 ? LEU A 113 VAL A 117 1 ? 5 HELX_P HELX_P3 3 THR A 129 ? ALA A 150 ? THR A 123 ALA A 144 1 ? 22 HELX_P HELX_P4 4 LYS A 158 ? SER A 160 ? LYS A 152 SER A 154 5 ? 3 HELX_P HELX_P5 5 ALA A 196 ? LEU A 201 ? ALA A 190 LEU A 195 1 ? 6 HELX_P HELX_P6 6 THR A 209 ? GLY A 225 ? THR A 203 GLY A 219 1 ? 17 HELX_P HELX_P7 7 ASP A 233 ? GLY A 246 ? ASP A 227 GLY A 240 1 ? 14 HELX_P HELX_P8 8 GLY A 249 ? ILE A 256 ? GLY A 243 ILE A 250 1 ? 8 HELX_P HELX_P9 9 SER A 258 ? GLN A 266 ? SER A 252 GLN A 260 1 ? 9 HELX_P HELX_P10 10 ASN A 275 ? VAL A 279 ? ASN A 269 VAL A 273 5 ? 5 HELX_P HELX_P11 11 ASN A 284 ? LEU A 295 ? ASN A 278 LEU A 289 1 ? 12 HELX_P HELX_P12 12 ASP A 298 ? ARG A 302 ? ASP A 292 ARG A 296 5 ? 5 HELX_P HELX_P13 13 THR A 304 ? ALA A 310 ? THR A 298 ALA A 304 1 ? 7 HELX_P HELX_P14 14 HIS A 311 ? ALA A 315 ? HIS A 305 ALA A 309 5 ? 5 HELX_P HELX_P15 15 GLN A 331 ? ARG A 336 ? GLN A 325 ARG A 330 5 ? 6 HELX_P HELX_P16 16 LEU A 339 ? SER A 353 ? LEU A 333 SER A 347 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 14 ? GLN A 17 ? PHE A 8 GLN A 11 A 2 TRP A 24 ? PRO A 27 ? TRP A 18 PRO A 21 B 1 TYR A 30 ? PRO A 35 ? TYR A 24 PRO A 29 B 2 GLY A 42 ? ASP A 49 ? GLY A 36 ASP A 43 B 3 ARG A 55 ? LEU A 61 ? ARG A 49 LEU A 55 B 4 TYR A 109 ? HIS A 113 ? TYR A 103 HIS A 107 B 5 ASP A 94 ? PHE A 96 ? ASP A 88 PHE A 90 C 1 ALA A 117 ? ASP A 118 ? ALA A 111 ASP A 112 C 2 LEU A 162 ? VAL A 164 ? LEU A 156 VAL A 158 C 3 LEU A 170 ? ILE A 172 ? LEU A 164 ILE A 166 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 17 ? N GLN A 11 O TRP A 24 ? O TRP A 18 B 1 2 N SER A 34 ? N SER A 28 O ALA A 46 ? O ALA A 40 B 2 3 N CYS A 45 ? N CYS A 39 O VAL A 58 ? O VAL A 52 B 3 4 N ALA A 57 ? N ALA A 51 O THR A 112 ? O THR A 106 B 4 5 O VAL A 111 ? O VAL A 105 N ASP A 94 ? N ASP A 88 C 1 2 N ALA A 117 ? N ALA A 111 O VAL A 164 ? O VAL A 158 C 2 3 N ALA A 163 ? N ALA A 157 O LYS A 171 ? O LYS A 165 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'BINDING SITE FOR RESIDUE 279 A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 VAL A 44 ? VAL A 38 . ? 1_555 ? 2 AC1 17 ALA A 57 ? ALA A 51 . ? 1_555 ? 3 AC1 17 LYS A 59 ? LYS A 53 . ? 1_555 ? 4 AC1 17 GLU A 77 ? GLU A 71 . ? 1_555 ? 5 AC1 17 LEU A 81 ? LEU A 75 . ? 1_555 ? 6 AC1 17 ILE A 90 ? ILE A 84 . ? 1_555 ? 7 AC1 17 THR A 112 ? THR A 106 . ? 1_555 ? 8 AC1 17 HIS A 113 ? HIS A 107 . ? 1_555 ? 9 AC1 17 LEU A 114 ? LEU A 108 . ? 1_555 ? 10 AC1 17 MET A 115 ? MET A 109 . ? 1_555 ? 11 AC1 17 ALA A 117 ? ALA A 111 . ? 1_555 ? 12 AC1 17 ASP A 118 ? ASP A 112 . ? 1_555 ? 13 AC1 17 LEU A 173 ? LEU A 167 . ? 1_555 ? 14 AC1 17 ASP A 174 ? ASP A 168 . ? 1_555 ? 15 AC1 17 PHE A 175 ? PHE A 169 . ? 1_555 ? 16 AC1 17 LEU A 177 ? LEU A 171 . ? 1_555 ? 17 AC1 17 HOH C . ? HOH A 503 . ? 1_555 ? # _atom_sites.entry_id 2RG5 _atom_sites.fract_transf_matrix[1][1] 0.014766 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013915 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012574 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -5 ? ? ? A . n A 1 2 ALA 2 -4 ? ? ? A . n A 1 3 HIS 3 -3 ? ? ? A . n A 1 4 HIS 4 -2 ? ? ? A . n A 1 5 HIS 5 -1 ? ? ? A . n A 1 6 HIS 6 0 ? ? ? A . n A 1 7 HIS 7 1 ? ? ? A . n A 1 8 SER 8 2 ? ? ? A . n A 1 9 GLN 9 3 ? ? ? A . n A 1 10 GLU 10 4 4 GLU GLU A . n A 1 11 ARG 11 5 5 ARG ARG A . n A 1 12 PRO 12 6 6 PRO PRO A . n A 1 13 THR 13 7 7 THR THR A . n A 1 14 PHE 14 8 8 PHE PHE A . n A 1 15 TYR 15 9 9 TYR TYR A . n A 1 16 ARG 16 10 10 ARG ARG A . n A 1 17 GLN 17 11 11 GLN GLN A . n A 1 18 GLU 18 12 12 GLU GLU A . n A 1 19 LEU 19 13 13 LEU LEU A . n A 1 20 ASN 20 14 14 ASN ASN A . n A 1 21 LYS 21 15 15 LYS LYS A . n A 1 22 THR 22 16 16 THR THR A . n A 1 23 ILE 23 17 17 ILE ILE A . n A 1 24 TRP 24 18 18 TRP TRP A . n A 1 25 GLU 25 19 19 GLU GLU A . n A 1 26 VAL 26 20 20 VAL VAL A . n A 1 27 PRO 27 21 21 PRO PRO A . n A 1 28 GLU 28 22 22 GLU GLU A . n A 1 29 ARG 29 23 23 ARG ARG A . n A 1 30 TYR 30 24 24 TYR TYR A . n A 1 31 GLN 31 25 25 GLN GLN A . n A 1 32 ASN 32 26 26 ASN ASN A . n A 1 33 LEU 33 27 27 LEU LEU A . n A 1 34 SER 34 28 28 SER SER A . n A 1 35 PRO 35 29 29 PRO PRO A . n A 1 36 VAL 36 30 30 VAL VAL A . n A 1 37 GLY 37 31 ? ? ? A . n A 1 38 SER 38 32 ? ? ? A . n A 1 39 GLY 39 33 ? ? ? A . n A 1 40 ALA 40 34 ? ? ? A . n A 1 41 TYR 41 35 35 TYR TYR A . n A 1 42 GLY 42 36 36 GLY GLY A . n A 1 43 SER 43 37 37 SER SER A . n A 1 44 VAL 44 38 38 VAL VAL A . n A 1 45 CYS 45 39 39 CYS CYS A . n A 1 46 ALA 46 40 40 ALA ALA A . n A 1 47 ALA 47 41 41 ALA ALA A . n A 1 48 PHE 48 42 42 PHE PHE A . n A 1 49 ASP 49 43 43 ASP ASP A . n A 1 50 THR 50 44 44 THR THR A . n A 1 51 LYS 51 45 45 LYS LYS A . n A 1 52 THR 52 46 46 THR THR A . n A 1 53 GLY 53 47 47 GLY GLY A . n A 1 54 LEU 54 48 48 LEU LEU A . n A 1 55 ARG 55 49 49 ARG ARG A . n A 1 56 VAL 56 50 50 VAL VAL A . n A 1 57 ALA 57 51 51 ALA ALA A . n A 1 58 VAL 58 52 52 VAL VAL A . n A 1 59 LYS 59 53 53 LYS LYS A . n A 1 60 LYS 60 54 54 LYS LYS A . n A 1 61 LEU 61 55 55 LEU LEU A . n A 1 62 SER 62 56 56 SER SER A . n A 1 63 ARG 63 57 57 ARG ARG A . n A 1 64 PRO 64 58 58 PRO PRO A . n A 1 65 PHE 65 59 59 PHE PHE A . n A 1 66 GLN 66 60 60 GLN GLN A . n A 1 67 SER 67 61 61 SER SER A . n A 1 68 ILE 68 62 62 ILE ILE A . n A 1 69 ILE 69 63 63 ILE ILE A . n A 1 70 HIS 70 64 64 HIS HIS A . n A 1 71 ALA 71 65 65 ALA ALA A . n A 1 72 LYS 72 66 66 LYS LYS A . n A 1 73 ARG 73 67 67 ARG ARG A . n A 1 74 THR 74 68 68 THR THR A . n A 1 75 TYR 75 69 69 TYR TYR A . n A 1 76 ARG 76 70 70 ARG ARG A . n A 1 77 GLU 77 71 71 GLU GLU A . n A 1 78 LEU 78 72 72 LEU LEU A . n A 1 79 ARG 79 73 73 ARG ARG A . n A 1 80 LEU 80 74 74 LEU LEU A . n A 1 81 LEU 81 75 75 LEU LEU A . n A 1 82 LYS 82 76 76 LYS LYS A . n A 1 83 HIS 83 77 77 HIS HIS A . n A 1 84 MET 84 78 78 MET MET A . n A 1 85 LYS 85 79 79 LYS LYS A . n A 1 86 HIS 86 80 80 HIS HIS A . n A 1 87 GLU 87 81 81 GLU GLU A . n A 1 88 ASN 88 82 82 ASN ASN A . n A 1 89 VAL 89 83 83 VAL VAL A . n A 1 90 ILE 90 84 84 ILE ILE A . n A 1 91 GLY 91 85 85 GLY GLY A . n A 1 92 LEU 92 86 86 LEU LEU A . n A 1 93 LEU 93 87 87 LEU LEU A . n A 1 94 ASP 94 88 88 ASP ASP A . n A 1 95 VAL 95 89 89 VAL VAL A . n A 1 96 PHE 96 90 90 PHE PHE A . n A 1 97 THR 97 91 91 THR THR A . n A 1 98 PRO 98 92 92 PRO PRO A . n A 1 99 ALA 99 93 93 ALA ALA A . n A 1 100 ARG 100 94 94 ARG ARG A . n A 1 101 SER 101 95 95 SER SER A . n A 1 102 LEU 102 96 96 LEU LEU A . n A 1 103 GLU 103 97 97 GLU GLU A . n A 1 104 GLU 104 98 98 GLU GLU A . n A 1 105 PHE 105 99 99 PHE PHE A . n A 1 106 ASN 106 100 100 ASN ASN A . n A 1 107 ASP 107 101 101 ASP ASP A . n A 1 108 VAL 108 102 102 VAL VAL A . n A 1 109 TYR 109 103 103 TYR TYR A . n A 1 110 LEU 110 104 104 LEU LEU A . n A 1 111 VAL 111 105 105 VAL VAL A . n A 1 112 THR 112 106 106 THR THR A . n A 1 113 HIS 113 107 107 HIS HIS A . n A 1 114 LEU 114 108 108 LEU LEU A . n A 1 115 MET 115 109 109 MET MET A . n A 1 116 GLY 116 110 110 GLY GLY A . n A 1 117 ALA 117 111 111 ALA ALA A . n A 1 118 ASP 118 112 112 ASP ASP A . n A 1 119 LEU 119 113 113 LEU LEU A . n A 1 120 ASN 120 114 114 ASN ASN A . n A 1 121 ASN 121 115 115 ASN ASN A . n A 1 122 ILE 122 116 116 ILE ILE A . n A 1 123 VAL 123 117 117 VAL VAL A . n A 1 124 LYS 124 118 118 LYS LYS A . n A 1 125 CYS 125 119 119 CYS CYS A . n A 1 126 GLN 126 120 120 GLN GLN A . n A 1 127 LYS 127 121 121 LYS LYS A . n A 1 128 LEU 128 122 122 LEU LEU A . n A 1 129 THR 129 123 123 THR THR A . n A 1 130 ASP 130 124 124 ASP ASP A . n A 1 131 ASP 131 125 125 ASP ASP A . n A 1 132 HIS 132 126 126 HIS HIS A . n A 1 133 VAL 133 127 127 VAL VAL A . n A 1 134 GLN 134 128 128 GLN GLN A . n A 1 135 PHE 135 129 129 PHE PHE A . n A 1 136 LEU 136 130 130 LEU LEU A . n A 1 137 ILE 137 131 131 ILE ILE A . n A 1 138 TYR 138 132 132 TYR TYR A . n A 1 139 GLN 139 133 133 GLN GLN A . n A 1 140 ILE 140 134 134 ILE ILE A . n A 1 141 LEU 141 135 135 LEU LEU A . n A 1 142 ARG 142 136 136 ARG ARG A . n A 1 143 GLY 143 137 137 GLY GLY A . n A 1 144 LEU 144 138 138 LEU LEU A . n A 1 145 LYS 145 139 139 LYS LYS A . n A 1 146 TYR 146 140 140 TYR TYR A . n A 1 147 ILE 147 141 141 ILE ILE A . n A 1 148 HIS 148 142 142 HIS HIS A . n A 1 149 SER 149 143 143 SER SER A . n A 1 150 ALA 150 144 144 ALA ALA A . n A 1 151 ASP 151 145 145 ASP ASP A . n A 1 152 ILE 152 146 146 ILE ILE A . n A 1 153 ILE 153 147 147 ILE ILE A . n A 1 154 HIS 154 148 148 HIS HIS A . n A 1 155 ARG 155 149 149 ARG ARG A . n A 1 156 ASP 156 150 150 ASP ASP A . n A 1 157 LEU 157 151 151 LEU LEU A . n A 1 158 LYS 158 152 152 LYS LYS A . n A 1 159 PRO 159 153 153 PRO PRO A . n A 1 160 SER 160 154 154 SER SER A . n A 1 161 ASN 161 155 155 ASN ASN A . n A 1 162 LEU 162 156 156 LEU LEU A . n A 1 163 ALA 163 157 157 ALA ALA A . n A 1 164 VAL 164 158 158 VAL VAL A . n A 1 165 ASN 165 159 159 ASN ASN A . n A 1 166 GLU 166 160 160 GLU GLU A . n A 1 167 ASP 167 161 161 ASP ASP A . n A 1 168 CYS 168 162 162 CYS CYS A . n A 1 169 GLU 169 163 163 GLU GLU A . n A 1 170 LEU 170 164 164 LEU LEU A . n A 1 171 LYS 171 165 165 LYS LYS A . n A 1 172 ILE 172 166 166 ILE ILE A . n A 1 173 LEU 173 167 167 LEU LEU A . n A 1 174 ASP 174 168 168 ASP ASP A . n A 1 175 PHE 175 169 169 PHE PHE A . n A 1 176 GLY 176 170 170 GLY GLY A . n A 1 177 LEU 177 171 171 LEU LEU A . n A 1 178 ALA 178 172 172 ALA ALA A . n A 1 179 ARG 179 173 173 ARG ARG A . n A 1 180 HIS 180 174 ? ? ? A . n A 1 181 THR 181 175 ? ? ? A . n A 1 182 ASP 182 176 ? ? ? A . n A 1 183 ASP 183 177 ? ? ? A . n A 1 184 GLU 184 178 ? ? ? A . n A 1 185 MET 185 179 ? ? ? A . n A 1 186 THR 186 180 ? ? ? A . n A 1 187 GLY 187 181 ? ? ? A . n A 1 188 TYR 188 182 ? ? ? A . n A 1 189 VAL 189 183 ? ? ? A . n A 1 190 ALA 190 184 ? ? ? A . n A 1 191 THR 191 185 185 THR THR A . n A 1 192 ARG 192 186 186 ARG ARG A . n A 1 193 TRP 193 187 187 TRP TRP A . n A 1 194 TYR 194 188 188 TYR TYR A . n A 1 195 ARG 195 189 189 ARG ARG A . n A 1 196 ALA 196 190 190 ALA ALA A . n A 1 197 PRO 197 191 191 PRO PRO A . n A 1 198 GLU 198 192 192 GLU GLU A . n A 1 199 ILE 199 193 193 ILE ILE A . n A 1 200 MET 200 194 194 MET MET A . n A 1 201 LEU 201 195 195 LEU LEU A . n A 1 202 ASN 202 196 196 ASN ASN A . n A 1 203 TRP 203 197 197 TRP TRP A . n A 1 204 MET 204 198 198 MET MET A . n A 1 205 HIS 205 199 199 HIS HIS A . n A 1 206 TYR 206 200 200 TYR TYR A . n A 1 207 ASN 207 201 201 ASN ASN A . n A 1 208 GLN 208 202 202 GLN GLN A . n A 1 209 THR 209 203 203 THR THR A . n A 1 210 VAL 210 204 204 VAL VAL A . n A 1 211 ASP 211 205 205 ASP ASP A . n A 1 212 ILE 212 206 206 ILE ILE A . n A 1 213 TRP 213 207 207 TRP TRP A . n A 1 214 SER 214 208 208 SER SER A . n A 1 215 VAL 215 209 209 VAL VAL A . n A 1 216 GLY 216 210 210 GLY GLY A . n A 1 217 CYS 217 211 211 CYS CYS A . n A 1 218 ILE 218 212 212 ILE ILE A . n A 1 219 MET 219 213 213 MET MET A . n A 1 220 ALA 220 214 214 ALA ALA A . n A 1 221 GLU 221 215 215 GLU GLU A . n A 1 222 LEU 222 216 216 LEU LEU A . n A 1 223 LEU 223 217 217 LEU LEU A . n A 1 224 THR 224 218 218 THR THR A . n A 1 225 GLY 225 219 219 GLY GLY A . n A 1 226 ARG 226 220 220 ARG ARG A . n A 1 227 THR 227 221 221 THR THR A . n A 1 228 LEU 228 222 222 LEU LEU A . n A 1 229 PHE 229 223 223 PHE PHE A . n A 1 230 PRO 230 224 224 PRO PRO A . n A 1 231 GLY 231 225 225 GLY GLY A . n A 1 232 THR 232 226 226 THR THR A . n A 1 233 ASP 233 227 227 ASP ASP A . n A 1 234 HIS 234 228 228 HIS HIS A . n A 1 235 ILE 235 229 229 ILE ILE A . n A 1 236 ASP 236 230 230 ASP ASP A . n A 1 237 GLN 237 231 231 GLN GLN A . n A 1 238 LEU 238 232 232 LEU LEU A . n A 1 239 LYS 239 233 233 LYS LYS A . n A 1 240 LEU 240 234 234 LEU LEU A . n A 1 241 ILE 241 235 235 ILE ILE A . n A 1 242 LEU 242 236 236 LEU LEU A . n A 1 243 ARG 243 237 237 ARG ARG A . n A 1 244 LEU 244 238 238 LEU LEU A . n A 1 245 VAL 245 239 239 VAL VAL A . n A 1 246 GLY 246 240 240 GLY GLY A . n A 1 247 THR 247 241 241 THR THR A . n A 1 248 PRO 248 242 242 PRO PRO A . n A 1 249 GLY 249 243 243 GLY GLY A . n A 1 250 ALA 250 244 244 ALA ALA A . n A 1 251 GLU 251 245 245 GLU GLU A . n A 1 252 LEU 252 246 246 LEU LEU A . n A 1 253 LEU 253 247 247 LEU LEU A . n A 1 254 LYS 254 248 248 LYS LYS A . n A 1 255 LYS 255 249 249 LYS LYS A . n A 1 256 ILE 256 250 250 ILE ILE A . n A 1 257 SER 257 251 251 SER SER A . n A 1 258 SER 258 252 252 SER SER A . n A 1 259 GLU 259 253 253 GLU GLU A . n A 1 260 SER 260 254 254 SER SER A . n A 1 261 ALA 261 255 255 ALA ALA A . n A 1 262 ARG 262 256 256 ARG ARG A . n A 1 263 ASN 263 257 257 ASN ASN A . n A 1 264 TYR 264 258 258 TYR TYR A . n A 1 265 ILE 265 259 259 ILE ILE A . n A 1 266 GLN 266 260 260 GLN GLN A . n A 1 267 SER 267 261 261 SER SER A . n A 1 268 LEU 268 262 262 LEU LEU A . n A 1 269 THR 269 263 263 THR THR A . n A 1 270 GLN 270 264 264 GLN GLN A . n A 1 271 MET 271 265 265 MET MET A . n A 1 272 PRO 272 266 266 PRO PRO A . n A 1 273 LYS 273 267 267 LYS LYS A . n A 1 274 MET 274 268 268 MET MET A . n A 1 275 ASN 275 269 269 ASN ASN A . n A 1 276 PHE 276 270 270 PHE PHE A . n A 1 277 ALA 277 271 271 ALA ALA A . n A 1 278 ASN 278 272 272 ASN ASN A . n A 1 279 VAL 279 273 273 VAL VAL A . n A 1 280 PHE 280 274 274 PHE PHE A . n A 1 281 ILE 281 275 275 ILE ILE A . n A 1 282 GLY 282 276 276 GLY GLY A . n A 1 283 ALA 283 277 277 ALA ALA A . n A 1 284 ASN 284 278 278 ASN ASN A . n A 1 285 PRO 285 279 279 PRO PRO A . n A 1 286 LEU 286 280 280 LEU LEU A . n A 1 287 ALA 287 281 281 ALA ALA A . n A 1 288 VAL 288 282 282 VAL VAL A . n A 1 289 ASP 289 283 283 ASP ASP A . n A 1 290 LEU 290 284 284 LEU LEU A . n A 1 291 LEU 291 285 285 LEU LEU A . n A 1 292 GLU 292 286 286 GLU GLU A . n A 1 293 LYS 293 287 287 LYS LYS A . n A 1 294 MET 294 288 288 MET MET A . n A 1 295 LEU 295 289 289 LEU LEU A . n A 1 296 VAL 296 290 290 VAL VAL A . n A 1 297 LEU 297 291 291 LEU LEU A . n A 1 298 ASP 298 292 292 ASP ASP A . n A 1 299 SER 299 293 293 SER SER A . n A 1 300 ASP 300 294 294 ASP ASP A . n A 1 301 LYS 301 295 295 LYS LYS A . n A 1 302 ARG 302 296 296 ARG ARG A . n A 1 303 ILE 303 297 297 ILE ILE A . n A 1 304 THR 304 298 298 THR THR A . n A 1 305 ALA 305 299 299 ALA ALA A . n A 1 306 ALA 306 300 300 ALA ALA A . n A 1 307 GLN 307 301 301 GLN GLN A . n A 1 308 ALA 308 302 302 ALA ALA A . n A 1 309 LEU 309 303 303 LEU LEU A . n A 1 310 ALA 310 304 304 ALA ALA A . n A 1 311 HIS 311 305 305 HIS HIS A . n A 1 312 ALA 312 306 306 ALA ALA A . n A 1 313 TYR 313 307 307 TYR TYR A . n A 1 314 PHE 314 308 308 PHE PHE A . n A 1 315 ALA 315 309 309 ALA ALA A . n A 1 316 GLN 316 310 310 GLN GLN A . n A 1 317 TYR 317 311 311 TYR TYR A . n A 1 318 HIS 318 312 312 HIS HIS A . n A 1 319 ASP 319 313 313 ASP ASP A . n A 1 320 PRO 320 314 314 PRO PRO A . n A 1 321 ASP 321 315 315 ASP ASP A . n A 1 322 ASP 322 316 316 ASP ASP A . n A 1 323 GLU 323 317 317 GLU GLU A . n A 1 324 PRO 324 318 318 PRO PRO A . n A 1 325 VAL 325 319 319 VAL VAL A . n A 1 326 ALA 326 320 320 ALA ALA A . n A 1 327 ASP 327 321 321 ASP ASP A . n A 1 328 PRO 328 322 322 PRO PRO A . n A 1 329 TYR 329 323 323 TYR TYR A . n A 1 330 ASP 330 324 324 ASP ASP A . n A 1 331 GLN 331 325 325 GLN GLN A . n A 1 332 SER 332 326 326 SER SER A . n A 1 333 PHE 333 327 327 PHE PHE A . n A 1 334 GLU 334 328 328 GLU GLU A . n A 1 335 SER 335 329 329 SER SER A . n A 1 336 ARG 336 330 330 ARG ARG A . n A 1 337 ASP 337 331 331 ASP ASP A . n A 1 338 LEU 338 332 332 LEU LEU A . n A 1 339 LEU 339 333 333 LEU LEU A . n A 1 340 ILE 340 334 334 ILE ILE A . n A 1 341 ASP 341 335 335 ASP ASP A . n A 1 342 GLU 342 336 336 GLU GLU A . n A 1 343 TRP 343 337 337 TRP TRP A . n A 1 344 LYS 344 338 338 LYS LYS A . n A 1 345 SER 345 339 339 SER SER A . n A 1 346 LEU 346 340 340 LEU LEU A . n A 1 347 THR 347 341 341 THR THR A . n A 1 348 TYR 348 342 342 TYR TYR A . n A 1 349 ASP 349 343 343 ASP ASP A . n A 1 350 GLU 350 344 344 GLU GLU A . n A 1 351 VAL 351 345 345 VAL VAL A . n A 1 352 ILE 352 346 346 ILE ILE A . n A 1 353 SER 353 347 347 SER SER A . n A 1 354 PHE 354 348 348 PHE PHE A . n A 1 355 VAL 355 349 349 VAL VAL A . n A 1 356 PRO 356 350 350 PRO PRO A . n A 1 357 PRO 357 351 351 PRO PRO A . n A 1 358 PRO 358 352 ? ? ? A . n A 1 359 LEU 359 353 ? ? ? A . n A 1 360 ASP 360 354 ? ? ? A . n A 1 361 GLN 361 355 ? ? ? A . n A 1 362 GLU 362 356 ? ? ? A . n A 1 363 GLU 363 357 ? ? ? A . n A 1 364 MET 364 358 ? ? ? A . n A 1 365 GLU 365 359 ? ? ? A . n A 1 366 SER 366 360 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 279 1 501 501 279 279 A . C 3 HOH 1 502 502 HOH HOH A . C 3 HOH 2 503 503 HOH HOH A . C 3 HOH 3 504 504 HOH HOH A . C 3 HOH 4 505 505 HOH HOH A . C 3 HOH 5 506 506 HOH HOH A . C 3 HOH 6 507 507 HOH HOH A . C 3 HOH 7 508 508 HOH HOH A . C 3 HOH 8 509 509 HOH HOH A . C 3 HOH 9 510 510 HOH HOH A . C 3 HOH 10 511 511 HOH HOH A . C 3 HOH 11 512 512 HOH HOH A . C 3 HOH 12 513 513 HOH HOH A . C 3 HOH 13 514 514 HOH HOH A . C 3 HOH 14 515 515 HOH HOH A . C 3 HOH 15 516 516 HOH HOH A . C 3 HOH 16 517 517 HOH HOH A . C 3 HOH 17 518 518 HOH HOH A . C 3 HOH 18 519 519 HOH HOH A . C 3 HOH 19 520 520 HOH HOH A . C 3 HOH 20 521 521 HOH HOH A . C 3 HOH 21 522 522 HOH HOH A . C 3 HOH 22 523 523 HOH HOH A . C 3 HOH 23 524 524 HOH HOH A . C 3 HOH 24 525 525 HOH HOH A . C 3 HOH 25 526 526 HOH HOH A . C 3 HOH 26 527 527 HOH HOH A . C 3 HOH 27 528 528 HOH HOH A . C 3 HOH 28 529 529 HOH HOH A . C 3 HOH 29 530 530 HOH HOH A . C 3 HOH 30 531 531 HOH HOH A . C 3 HOH 31 532 532 HOH HOH A . C 3 HOH 32 533 533 HOH HOH A . C 3 HOH 33 534 534 HOH HOH A . C 3 HOH 34 535 535 HOH HOH A . C 3 HOH 35 536 536 HOH HOH A . C 3 HOH 36 537 537 HOH HOH A . C 3 HOH 37 538 538 HOH HOH A . C 3 HOH 38 539 539 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-01-15 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal BUSTER-TNT refinement 2.1.1 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 AMoRE phasing . ? 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A ARG 5 ? ? N A PRO 6 ? ? CD A PRO 6 ? ? 94.89 128.40 -33.51 2.10 Y 2 1 C A GLU 317 ? ? N A PRO 318 ? ? CA A PRO 318 ? ? 129.46 119.30 10.16 1.50 Y 3 1 C A GLU 317 ? ? N A PRO 318 ? ? CD A PRO 318 ? ? 114.56 128.40 -13.84 2.10 Y 4 1 C A ASP 321 ? ? N A PRO 322 ? ? CD A PRO 322 ? ? 106.40 128.40 -22.00 2.10 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 5 ? ? -50.18 -179.22 2 1 ASN A 14 ? ? 121.98 -55.78 3 1 LYS A 15 ? ? 139.13 3.03 4 1 SER A 61 ? ? -172.43 149.36 5 1 ASN A 100 ? ? -153.66 1.45 6 1 LYS A 118 ? ? -50.19 77.66 7 1 ASP A 145 ? ? 73.08 31.99 8 1 ARG A 149 ? ? 89.60 -20.10 9 1 ASP A 150 ? ? -145.01 51.18 10 1 ALA A 172 ? ? -53.15 5.16 11 1 ARG A 186 ? ? -150.60 -16.44 12 1 TRP A 197 ? ? -75.80 -143.20 13 1 MET A 198 ? ? -22.71 122.46 14 1 HIS A 199 ? ? -36.25 128.40 15 1 ASP A 227 ? ? 176.01 164.64 16 1 PHE A 274 ? ? -101.30 62.50 17 1 LEU A 289 ? ? -93.99 54.36 18 1 PRO A 322 ? ? -31.77 137.19 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 15 ? CG ? A LYS 21 CG 2 1 Y 1 A LYS 15 ? CD ? A LYS 21 CD 3 1 Y 1 A LYS 15 ? CE ? A LYS 21 CE 4 1 Y 1 A LYS 15 ? NZ ? A LYS 21 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -5 ? A MET 1 2 1 Y 1 A ALA -4 ? A ALA 2 3 1 Y 1 A HIS -3 ? A HIS 3 4 1 Y 1 A HIS -2 ? A HIS 4 5 1 Y 1 A HIS -1 ? A HIS 5 6 1 Y 1 A HIS 0 ? A HIS 6 7 1 Y 1 A HIS 1 ? A HIS 7 8 1 Y 1 A SER 2 ? A SER 8 9 1 Y 1 A GLN 3 ? A GLN 9 10 1 Y 1 A GLY 31 ? A GLY 37 11 1 Y 1 A SER 32 ? A SER 38 12 1 Y 1 A GLY 33 ? A GLY 39 13 1 Y 1 A ALA 34 ? A ALA 40 14 1 Y 1 A HIS 174 ? A HIS 180 15 1 Y 1 A THR 175 ? A THR 181 16 1 Y 1 A ASP 176 ? A ASP 182 17 1 Y 1 A ASP 177 ? A ASP 183 18 1 Y 1 A GLU 178 ? A GLU 184 19 1 Y 1 A MET 179 ? A MET 185 20 1 Y 1 A THR 180 ? A THR 186 21 1 Y 1 A GLY 181 ? A GLY 187 22 1 Y 1 A TYR 182 ? A TYR 188 23 1 Y 1 A VAL 183 ? A VAL 189 24 1 Y 1 A ALA 184 ? A ALA 190 25 1 Y 1 A PRO 352 ? A PRO 358 26 1 Y 1 A LEU 353 ? A LEU 359 27 1 Y 1 A ASP 354 ? A ASP 360 28 1 Y 1 A GLN 355 ? A GLN 361 29 1 Y 1 A GLU 356 ? A GLU 362 30 1 Y 1 A GLU 357 ? A GLU 363 31 1 Y 1 A MET 358 ? A MET 364 32 1 Y 1 A GLU 359 ? A GLU 365 33 1 Y 1 A SER 360 ? A SER 366 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'N-ethyl-4-{[5-(methoxycarbamoyl)-2-methylphenyl]amino}-5-methylpyrrolo[2,1-f][1,2,4]triazine-6-carboxamide' 279 3 water HOH #