data_2RLW # _entry.id 2RLW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RLW pdb_00002rlw 10.2210/pdb2rlw/pdb RCSB RCSB150017 ? ? WWPDB D_1000150017 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-07-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RLW _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-27 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JUI _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fimland, N.' 1 'Rogne, P.' 2 'Fimland, G.' 3 'Nissen-Meyer, J.' 4 'Kristiansen, P.' 5 # _citation.id primary _citation.title 'Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaricin EF' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1784 _citation.page_first 1711 _citation.page_last 1719 _citation.year 2008 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18555030 _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2008.05.003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fimland, N.' 1 ? primary 'Rogne, P.' 2 ? primary 'Fimland, G.' 3 ? primary 'Nissen-Meyer, J.' 4 ? primary 'Kristiansen, P.E.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description PlnF _entity.formula_weight 3709.182 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bacteriocin peptide PlnF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG _entity_poly.pdbx_seq_one_letter_code_can VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 HIS n 1 4 ALA n 1 5 TYR n 1 6 SER n 1 7 ALA n 1 8 ARG n 1 9 GLY n 1 10 VAL n 1 11 ARG n 1 12 ASN n 1 13 ASN n 1 14 TYR n 1 15 LYS n 1 16 SER n 1 17 ALA n 1 18 VAL n 1 19 GLY n 1 20 PRO n 1 21 ALA n 1 22 ASP n 1 23 TRP n 1 24 VAL n 1 25 ILE n 1 26 SER n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 GLY n 1 31 PHE n 1 32 ILE n 1 33 HIS n 1 34 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene plnF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain C11 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus plantarum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain bl21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pgev2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RLW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RLW _struct.title 'Three-Dimensional Structure of the two Peptides that Constitute the Two-Peptide Bacteriocin Plantaracin EF' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RLW _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'peptide plnF, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P71469_LACPL _struct_ref.pdbx_db_accession P71469 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RLW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71469 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 52 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 6 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 2 ? ? -157.69 53.66 2 1 HIS A 3 ? ? -176.91 -38.77 3 2 PHE A 2 ? ? -169.25 39.10 4 2 HIS A 3 ? ? -176.89 -38.80 5 3 HIS A 3 ? ? -176.91 -38.78 6 3 TYR A 5 ? ? -64.44 -176.30 7 3 SER A 6 ? ? 40.66 91.12 8 4 PHE A 2 ? ? -164.90 44.64 9 4 HIS A 3 ? ? -176.92 -38.77 10 4 TYR A 5 ? ? 49.54 -177.01 11 4 SER A 6 ? ? 44.26 93.34 12 5 PHE A 2 ? ? -159.55 33.89 13 5 HIS A 3 ? ? -176.86 -38.81 14 5 TYR A 5 ? ? 49.06 -172.51 15 5 SER A 6 ? ? 42.48 92.12 16 6 PHE A 2 ? ? -162.44 41.88 17 6 HIS A 3 ? ? -176.90 -38.81 18 6 TYR A 5 ? ? 53.30 -173.14 19 6 SER A 6 ? ? 43.96 93.41 20 7 HIS A 3 ? ? -176.81 -38.54 21 7 TYR A 5 ? ? -72.10 -169.14 22 7 SER A 6 ? ? 39.52 86.32 23 8 PHE A 2 ? ? 75.30 31.35 24 8 HIS A 3 ? ? -176.77 -38.84 25 8 SER A 6 ? ? 45.62 94.37 26 9 PHE A 2 ? ? 75.34 31.26 27 9 HIS A 3 ? ? -176.70 -38.85 28 10 PHE A 2 ? ? -87.15 40.09 29 10 HIS A 3 ? ? -177.00 -38.80 30 10 TYR A 5 ? ? 44.39 -169.59 31 10 SER A 6 ? ? 39.46 87.90 32 11 PHE A 2 ? ? -172.33 44.81 33 11 HIS A 3 ? ? -176.91 -38.77 34 11 TYR A 5 ? ? 44.93 -170.04 35 11 SER A 6 ? ? 44.42 93.54 36 12 HIS A 3 ? ? -176.93 -38.72 37 13 PHE A 2 ? ? -164.39 47.41 38 13 HIS A 3 ? ? -176.92 -38.76 39 13 TYR A 5 ? ? 52.66 -172.31 40 13 SER A 6 ? ? 45.14 94.02 41 14 PHE A 2 ? ? -153.23 52.14 42 14 HIS A 3 ? ? -176.90 -38.79 43 15 PHE A 2 ? ? -164.23 51.33 44 15 HIS A 3 ? ? -176.95 -38.83 45 15 TYR A 5 ? ? -170.41 -149.45 46 15 SER A 6 ? ? 39.68 90.65 47 16 PHE A 2 ? ? -157.08 38.97 48 16 HIS A 3 ? ? -176.94 -38.84 49 16 SER A 6 ? ? 39.41 87.76 50 17 PHE A 2 ? ? -86.68 42.50 51 17 HIS A 3 ? ? -174.12 -44.22 52 17 TYR A 5 ? ? 47.52 -175.76 53 17 SER A 6 ? ? 41.84 91.77 54 18 HIS A 3 ? ? -146.53 -46.82 55 19 PHE A 2 ? ? 175.14 38.06 56 19 HIS A 3 ? ? -176.93 -38.77 57 20 PHE A 2 ? ? -167.95 39.75 58 20 HIS A 3 ? ? -176.87 -38.78 59 20 TYR A 5 ? ? 49.25 -170.03 60 20 SER A 6 ? ? 43.04 92.45 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RLW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RLW _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '0.2 mM DSS, 0.1 % TFA, 200 mM [U-2H] DPC, 1 mM [U-95% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DSS 0.2 mM ? 1 TFA 0.1 % ? 1 DPC 200 mM '[U-2H]' 1 entity 1 mM '[U-95% 15N]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 2.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D 1H-15N TOCSY' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D HNHA' # _pdbx_nmr_refine.entry_id 2RLW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 Delaglio 'torsion angle determination' TALOS ? 2 Goddard 'chemical shift assignment' Sparky ? 3 Bruker processing TopSpin ? 4 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLY N N N N 74 GLY CA C N N 75 GLY C C N N 76 GLY O O N N 77 GLY OXT O N N 78 GLY H H N N 79 GLY H2 H N N 80 GLY HA2 H N N 81 GLY HA3 H N N 82 GLY HXT H N N 83 HIS N N N N 84 HIS CA C N S 85 HIS C C N N 86 HIS O O N N 87 HIS CB C N N 88 HIS CG C Y N 89 HIS ND1 N Y N 90 HIS CD2 C Y N 91 HIS CE1 C Y N 92 HIS NE2 N Y N 93 HIS OXT O N N 94 HIS H H N N 95 HIS H2 H N N 96 HIS HA H N N 97 HIS HB2 H N N 98 HIS HB3 H N N 99 HIS HD1 H N N 100 HIS HD2 H N N 101 HIS HE1 H N N 102 HIS HE2 H N N 103 HIS HXT H N N 104 ILE N N N N 105 ILE CA C N S 106 ILE C C N N 107 ILE O O N N 108 ILE CB C N S 109 ILE CG1 C N N 110 ILE CG2 C N N 111 ILE CD1 C N N 112 ILE OXT O N N 113 ILE H H N N 114 ILE H2 H N N 115 ILE HA H N N 116 ILE HB H N N 117 ILE HG12 H N N 118 ILE HG13 H N N 119 ILE HG21 H N N 120 ILE HG22 H N N 121 ILE HG23 H N N 122 ILE HD11 H N N 123 ILE HD12 H N N 124 ILE HD13 H N N 125 ILE HXT H N N 126 LYS N N N N 127 LYS CA C N S 128 LYS C C N N 129 LYS O O N N 130 LYS CB C N N 131 LYS CG C N N 132 LYS CD C N N 133 LYS CE C N N 134 LYS NZ N N N 135 LYS OXT O N N 136 LYS H H N N 137 LYS H2 H N N 138 LYS HA H N N 139 LYS HB2 H N N 140 LYS HB3 H N N 141 LYS HG2 H N N 142 LYS HG3 H N N 143 LYS HD2 H N N 144 LYS HD3 H N N 145 LYS HE2 H N N 146 LYS HE3 H N N 147 LYS HZ1 H N N 148 LYS HZ2 H N N 149 LYS HZ3 H N N 150 LYS HXT H N N 151 PHE N N N N 152 PHE CA C N S 153 PHE C C N N 154 PHE O O N N 155 PHE CB C N N 156 PHE CG C Y N 157 PHE CD1 C Y N 158 PHE CD2 C Y N 159 PHE CE1 C Y N 160 PHE CE2 C Y N 161 PHE CZ C Y N 162 PHE OXT O N N 163 PHE H H N N 164 PHE H2 H N N 165 PHE HA H N N 166 PHE HB2 H N N 167 PHE HB3 H N N 168 PHE HD1 H N N 169 PHE HD2 H N N 170 PHE HE1 H N N 171 PHE HE2 H N N 172 PHE HZ H N N 173 PHE HXT H N N 174 PRO N N N N 175 PRO CA C N S 176 PRO C C N N 177 PRO O O N N 178 PRO CB C N N 179 PRO CG C N N 180 PRO CD C N N 181 PRO OXT O N N 182 PRO H H N N 183 PRO HA H N N 184 PRO HB2 H N N 185 PRO HB3 H N N 186 PRO HG2 H N N 187 PRO HG3 H N N 188 PRO HD2 H N N 189 PRO HD3 H N N 190 PRO HXT H N N 191 SER N N N N 192 SER CA C N S 193 SER C C N N 194 SER O O N N 195 SER CB C N N 196 SER OG O N N 197 SER OXT O N N 198 SER H H N N 199 SER H2 H N N 200 SER HA H N N 201 SER HB2 H N N 202 SER HB3 H N N 203 SER HG H N N 204 SER HXT H N N 205 TRP N N N N 206 TRP CA C N S 207 TRP C C N N 208 TRP O O N N 209 TRP CB C N N 210 TRP CG C Y N 211 TRP CD1 C Y N 212 TRP CD2 C Y N 213 TRP NE1 N Y N 214 TRP CE2 C Y N 215 TRP CE3 C Y N 216 TRP CZ2 C Y N 217 TRP CZ3 C Y N 218 TRP CH2 C Y N 219 TRP OXT O N N 220 TRP H H N N 221 TRP H2 H N N 222 TRP HA H N N 223 TRP HB2 H N N 224 TRP HB3 H N N 225 TRP HD1 H N N 226 TRP HE1 H N N 227 TRP HE3 H N N 228 TRP HZ2 H N N 229 TRP HZ3 H N N 230 TRP HH2 H N N 231 TRP HXT H N N 232 TYR N N N N 233 TYR CA C N S 234 TYR C C N N 235 TYR O O N N 236 TYR CB C N N 237 TYR CG C Y N 238 TYR CD1 C Y N 239 TYR CD2 C Y N 240 TYR CE1 C Y N 241 TYR CE2 C Y N 242 TYR CZ C Y N 243 TYR OH O N N 244 TYR OXT O N N 245 TYR H H N N 246 TYR H2 H N N 247 TYR HA H N N 248 TYR HB2 H N N 249 TYR HB3 H N N 250 TYR HD1 H N N 251 TYR HD2 H N N 252 TYR HE1 H N N 253 TYR HE2 H N N 254 TYR HH H N N 255 TYR HXT H N N 256 VAL N N N N 257 VAL CA C N S 258 VAL C C N N 259 VAL O O N N 260 VAL CB C N N 261 VAL CG1 C N N 262 VAL CG2 C N N 263 VAL OXT O N N 264 VAL H H N N 265 VAL H2 H N N 266 VAL HA H N N 267 VAL HB H N N 268 VAL HG11 H N N 269 VAL HG12 H N N 270 VAL HG13 H N N 271 VAL HG21 H N N 272 VAL HG22 H N N 273 VAL HG23 H N N 274 VAL HXT H N N 275 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLY N CA sing N N 70 GLY N H sing N N 71 GLY N H2 sing N N 72 GLY CA C sing N N 73 GLY CA HA2 sing N N 74 GLY CA HA3 sing N N 75 GLY C O doub N N 76 GLY C OXT sing N N 77 GLY OXT HXT sing N N 78 HIS N CA sing N N 79 HIS N H sing N N 80 HIS N H2 sing N N 81 HIS CA C sing N N 82 HIS CA CB sing N N 83 HIS CA HA sing N N 84 HIS C O doub N N 85 HIS C OXT sing N N 86 HIS CB CG sing N N 87 HIS CB HB2 sing N N 88 HIS CB HB3 sing N N 89 HIS CG ND1 sing Y N 90 HIS CG CD2 doub Y N 91 HIS ND1 CE1 doub Y N 92 HIS ND1 HD1 sing N N 93 HIS CD2 NE2 sing Y N 94 HIS CD2 HD2 sing N N 95 HIS CE1 NE2 sing Y N 96 HIS CE1 HE1 sing N N 97 HIS NE2 HE2 sing N N 98 HIS OXT HXT sing N N 99 ILE N CA sing N N 100 ILE N H sing N N 101 ILE N H2 sing N N 102 ILE CA C sing N N 103 ILE CA CB sing N N 104 ILE CA HA sing N N 105 ILE C O doub N N 106 ILE C OXT sing N N 107 ILE CB CG1 sing N N 108 ILE CB CG2 sing N N 109 ILE CB HB sing N N 110 ILE CG1 CD1 sing N N 111 ILE CG1 HG12 sing N N 112 ILE CG1 HG13 sing N N 113 ILE CG2 HG21 sing N N 114 ILE CG2 HG22 sing N N 115 ILE CG2 HG23 sing N N 116 ILE CD1 HD11 sing N N 117 ILE CD1 HD12 sing N N 118 ILE CD1 HD13 sing N N 119 ILE OXT HXT sing N N 120 LYS N CA sing N N 121 LYS N H sing N N 122 LYS N H2 sing N N 123 LYS CA C sing N N 124 LYS CA CB sing N N 125 LYS CA HA sing N N 126 LYS C O doub N N 127 LYS C OXT sing N N 128 LYS CB CG sing N N 129 LYS CB HB2 sing N N 130 LYS CB HB3 sing N N 131 LYS CG CD sing N N 132 LYS CG HG2 sing N N 133 LYS CG HG3 sing N N 134 LYS CD CE sing N N 135 LYS CD HD2 sing N N 136 LYS CD HD3 sing N N 137 LYS CE NZ sing N N 138 LYS CE HE2 sing N N 139 LYS CE HE3 sing N N 140 LYS NZ HZ1 sing N N 141 LYS NZ HZ2 sing N N 142 LYS NZ HZ3 sing N N 143 LYS OXT HXT sing N N 144 PHE N CA sing N N 145 PHE N H sing N N 146 PHE N H2 sing N N 147 PHE CA C sing N N 148 PHE CA CB sing N N 149 PHE CA HA sing N N 150 PHE C O doub N N 151 PHE C OXT sing N N 152 PHE CB CG sing N N 153 PHE CB HB2 sing N N 154 PHE CB HB3 sing N N 155 PHE CG CD1 doub Y N 156 PHE CG CD2 sing Y N 157 PHE CD1 CE1 sing Y N 158 PHE CD1 HD1 sing N N 159 PHE CD2 CE2 doub Y N 160 PHE CD2 HD2 sing N N 161 PHE CE1 CZ doub Y N 162 PHE CE1 HE1 sing N N 163 PHE CE2 CZ sing Y N 164 PHE CE2 HE2 sing N N 165 PHE CZ HZ sing N N 166 PHE OXT HXT sing N N 167 PRO N CA sing N N 168 PRO N CD sing N N 169 PRO N H sing N N 170 PRO CA C sing N N 171 PRO CA CB sing N N 172 PRO CA HA sing N N 173 PRO C O doub N N 174 PRO C OXT sing N N 175 PRO CB CG sing N N 176 PRO CB HB2 sing N N 177 PRO CB HB3 sing N N 178 PRO CG CD sing N N 179 PRO CG HG2 sing N N 180 PRO CG HG3 sing N N 181 PRO CD HD2 sing N N 182 PRO CD HD3 sing N N 183 PRO OXT HXT sing N N 184 SER N CA sing N N 185 SER N H sing N N 186 SER N H2 sing N N 187 SER CA C sing N N 188 SER CA CB sing N N 189 SER CA HA sing N N 190 SER C O doub N N 191 SER C OXT sing N N 192 SER CB OG sing N N 193 SER CB HB2 sing N N 194 SER CB HB3 sing N N 195 SER OG HG sing N N 196 SER OXT HXT sing N N 197 TRP N CA sing N N 198 TRP N H sing N N 199 TRP N H2 sing N N 200 TRP CA C sing N N 201 TRP CA CB sing N N 202 TRP CA HA sing N N 203 TRP C O doub N N 204 TRP C OXT sing N N 205 TRP CB CG sing N N 206 TRP CB HB2 sing N N 207 TRP CB HB3 sing N N 208 TRP CG CD1 doub Y N 209 TRP CG CD2 sing Y N 210 TRP CD1 NE1 sing Y N 211 TRP CD1 HD1 sing N N 212 TRP CD2 CE2 doub Y N 213 TRP CD2 CE3 sing Y N 214 TRP NE1 CE2 sing Y N 215 TRP NE1 HE1 sing N N 216 TRP CE2 CZ2 sing Y N 217 TRP CE3 CZ3 doub Y N 218 TRP CE3 HE3 sing N N 219 TRP CZ2 CH2 doub Y N 220 TRP CZ2 HZ2 sing N N 221 TRP CZ3 CH2 sing Y N 222 TRP CZ3 HZ3 sing N N 223 TRP CH2 HH2 sing N N 224 TRP OXT HXT sing N N 225 TYR N CA sing N N 226 TYR N H sing N N 227 TYR N H2 sing N N 228 TYR CA C sing N N 229 TYR CA CB sing N N 230 TYR CA HA sing N N 231 TYR C O doub N N 232 TYR C OXT sing N N 233 TYR CB CG sing N N 234 TYR CB HB2 sing N N 235 TYR CB HB3 sing N N 236 TYR CG CD1 doub Y N 237 TYR CG CD2 sing Y N 238 TYR CD1 CE1 sing Y N 239 TYR CD1 HD1 sing N N 240 TYR CD2 CE2 doub Y N 241 TYR CD2 HD2 sing N N 242 TYR CE1 CZ doub Y N 243 TYR CE1 HE1 sing N N 244 TYR CE2 CZ sing Y N 245 TYR CE2 HE2 sing N N 246 TYR CZ OH sing N N 247 TYR OH HH sing N N 248 TYR OXT HXT sing N N 249 VAL N CA sing N N 250 VAL N H sing N N 251 VAL N H2 sing N N 252 VAL CA C sing N N 253 VAL CA CB sing N N 254 VAL CA HA sing N N 255 VAL C O doub N N 256 VAL C OXT sing N N 257 VAL CB CG1 sing N N 258 VAL CB CG2 sing N N 259 VAL CB HB sing N N 260 VAL CG1 HG11 sing N N 261 VAL CG1 HG12 sing N N 262 VAL CG1 HG13 sing N N 263 VAL CG2 HG21 sing N N 264 VAL CG2 HG22 sing N N 265 VAL CG2 HG23 sing N N 266 VAL OXT HXT sing N N 267 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2RLW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_