data_2RLW # _entry.id 2RLW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RLW pdb_00002rlw 10.2210/pdb2rlw/pdb RCSB RCSB150017 ? ? WWPDB D_1000150017 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2JUI _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RLW _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-08-27 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Fimland, N.' 1 'Rogne, P.' 2 'Fimland, G.' 3 'Nissen-Meyer, J.' 4 'Kristiansen, P.' 5 # _citation.id primary _citation.title 'Three-dimensional structure of the two peptides that constitute the two-peptide bacteriocin plantaricin EF' _citation.journal_abbrev Biochim.Biophys.Acta _citation.journal_volume 1784 _citation.page_first 1711 _citation.page_last 1719 _citation.year 2008 _citation.journal_id_ASTM BBACAQ _citation.country NE _citation.journal_id_ISSN 0006-3002 _citation.journal_id_CSD 0113 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18555030 _citation.pdbx_database_id_DOI 10.1016/j.bbapap.2008.05.003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fimland, N.' 1 ? primary 'Rogne, P.' 2 ? primary 'Fimland, G.' 3 ? primary 'Nissen-Meyer, J.' 4 ? primary 'Kristiansen, P.E.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description PlnF _entity.formula_weight 3709.182 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bacteriocin peptide PlnF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG _entity_poly.pdbx_seq_one_letter_code_can VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 PHE n 1 3 HIS n 1 4 ALA n 1 5 TYR n 1 6 SER n 1 7 ALA n 1 8 ARG n 1 9 GLY n 1 10 VAL n 1 11 ARG n 1 12 ASN n 1 13 ASN n 1 14 TYR n 1 15 LYS n 1 16 SER n 1 17 ALA n 1 18 VAL n 1 19 GLY n 1 20 PRO n 1 21 ALA n 1 22 ASP n 1 23 TRP n 1 24 VAL n 1 25 ILE n 1 26 SER n 1 27 ALA n 1 28 VAL n 1 29 ARG n 1 30 GLY n 1 31 PHE n 1 32 ILE n 1 33 HIS n 1 34 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene plnF _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain C11 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactobacillus plantarum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain bl21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pgev2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P71469_LACPL _struct_ref.pdbx_db_accession P71469 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RLW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71469 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 52 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D 1H-15N TOCSY' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D HNHA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 2.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.2 mM DSS, 0.1 % TFA, 200 mM [U-2H] DPC, 1 mM [U-95% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RLW _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RLW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RLW _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 Delaglio 'torsion angle determination' TALOS ? 2 Goddard 'chemical shift assignment' Sparky ? 3 Bruker processing TopSpin ? 4 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RLW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RLW _struct.title 'Three-Dimensional Structure of the two Peptides that Constitute the Two-Peptide Bacteriocin Plantaracin EF' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RLW _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'peptide plnF, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 6 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 33 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 6 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2RLW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 TRP 23 23 23 TRP TRP A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-07-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DSS 0.2 mM ? 1 TFA 0.1 % ? 1 DPC 200 mM '[U-2H]' 1 entity 1 mM '[U-95% 15N]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 2 ? ? -157.69 53.66 2 1 HIS A 3 ? ? -176.91 -38.77 3 2 PHE A 2 ? ? -169.25 39.10 4 2 HIS A 3 ? ? -176.89 -38.80 5 3 HIS A 3 ? ? -176.91 -38.78 6 3 TYR A 5 ? ? -64.44 -176.30 7 3 SER A 6 ? ? 40.66 91.12 8 4 PHE A 2 ? ? -164.90 44.64 9 4 HIS A 3 ? ? -176.92 -38.77 10 4 TYR A 5 ? ? 49.54 -177.01 11 4 SER A 6 ? ? 44.26 93.34 12 5 PHE A 2 ? ? -159.55 33.89 13 5 HIS A 3 ? ? -176.86 -38.81 14 5 TYR A 5 ? ? 49.06 -172.51 15 5 SER A 6 ? ? 42.48 92.12 16 6 PHE A 2 ? ? -162.44 41.88 17 6 HIS A 3 ? ? -176.90 -38.81 18 6 TYR A 5 ? ? 53.30 -173.14 19 6 SER A 6 ? ? 43.96 93.41 20 7 HIS A 3 ? ? -176.81 -38.54 21 7 TYR A 5 ? ? -72.10 -169.14 22 7 SER A 6 ? ? 39.52 86.32 23 8 PHE A 2 ? ? 75.30 31.35 24 8 HIS A 3 ? ? -176.77 -38.84 25 8 SER A 6 ? ? 45.62 94.37 26 9 PHE A 2 ? ? 75.34 31.26 27 9 HIS A 3 ? ? -176.70 -38.85 28 10 PHE A 2 ? ? -87.15 40.09 29 10 HIS A 3 ? ? -177.00 -38.80 30 10 TYR A 5 ? ? 44.39 -169.59 31 10 SER A 6 ? ? 39.46 87.90 32 11 PHE A 2 ? ? -172.33 44.81 33 11 HIS A 3 ? ? -176.91 -38.77 34 11 TYR A 5 ? ? 44.93 -170.04 35 11 SER A 6 ? ? 44.42 93.54 36 12 HIS A 3 ? ? -176.93 -38.72 37 13 PHE A 2 ? ? -164.39 47.41 38 13 HIS A 3 ? ? -176.92 -38.76 39 13 TYR A 5 ? ? 52.66 -172.31 40 13 SER A 6 ? ? 45.14 94.02 41 14 PHE A 2 ? ? -153.23 52.14 42 14 HIS A 3 ? ? -176.90 -38.79 43 15 PHE A 2 ? ? -164.23 51.33 44 15 HIS A 3 ? ? -176.95 -38.83 45 15 TYR A 5 ? ? -170.41 -149.45 46 15 SER A 6 ? ? 39.68 90.65 47 16 PHE A 2 ? ? -157.08 38.97 48 16 HIS A 3 ? ? -176.94 -38.84 49 16 SER A 6 ? ? 39.41 87.76 50 17 PHE A 2 ? ? -86.68 42.50 51 17 HIS A 3 ? ? -174.12 -44.22 52 17 TYR A 5 ? ? 47.52 -175.76 53 17 SER A 6 ? ? 41.84 91.77 54 18 HIS A 3 ? ? -146.53 -46.82 55 19 PHE A 2 ? ? 175.14 38.06 56 19 HIS A 3 ? ? -176.93 -38.77 57 20 PHE A 2 ? ? -167.95 39.75 58 20 HIS A 3 ? ? -176.87 -38.78 59 20 TYR A 5 ? ? 49.25 -170.03 60 20 SER A 6 ? ? 43.04 92.45 #