data_2RNL # _entry.id 2RNL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RNL pdb_00002rnl 10.2210/pdb2rnl/pdb RCSB RCSB150068 ? ? WWPDB D_1000150068 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ar_001000440.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RNL _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-01-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.' 1 'Hayashi, F.' 2 'Terada, T.' 3 'Shirouzu, M.' 4 'Watanabe, S.' 5 'Kigawa, T.' 6 'Yabuta, N.' 7 'Nojima, H.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title 'Solution structure of the EGF-like domain from human Amphiregulin' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Terada, T.' 3 ? primary 'Shirouzu, M.' 4 ? primary 'Watanabe, S.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yabuta, N.' 7 ? primary 'Nojima, H.' 8 ? primary 'Yokoyama, S.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Amphiregulin _entity.formula_weight 5584.219 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'EGF-like domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AR, Colorectum cell-derived growth factor, CRDGF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEK _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000440.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 LYS n 1 10 ASN n 1 11 PRO n 1 12 CYS n 1 13 ASN n 1 14 ALA n 1 15 GLU n 1 16 PHE n 1 17 GLN n 1 18 ASN n 1 19 PHE n 1 20 CYS n 1 21 ILE n 1 22 HIS n 1 23 GLY n 1 24 GLU n 1 25 CYS n 1 26 LYS n 1 27 TYR n 1 28 ILE n 1 29 GLU n 1 30 HIS n 1 31 LEU n 1 32 GLU n 1 33 ALA n 1 34 VAL n 1 35 THR n 1 36 CYS n 1 37 LYS n 1 38 CYS n 1 39 GLN n 1 40 GLN n 1 41 GLU n 1 42 TYR n 1 43 PHE n 1 44 GLY n 1 45 GLU n 1 46 ARG n 1 47 CYS n 1 48 GLY n 1 49 GLU n 1 50 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AREG, SDGF' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE PROTEIN SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector P061201-18 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'E. coli CELL-FREE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AREG_HUMAN _struct_ref.pdbx_db_accession P15514 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEK _struct_ref.pdbx_align_begin 142 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RNL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15514 _struct_ref_seq.db_align_beg 142 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 184 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 50 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RNL GLY A 1 ? UNP P15514 ? ? 'expression tag' 1 1 1 2RNL SER A 2 ? UNP P15514 ? ? 'expression tag' 2 2 1 2RNL SER A 3 ? UNP P15514 ? ? 'expression tag' 3 3 1 2RNL GLY A 4 ? UNP P15514 ? ? 'expression tag' 4 4 1 2RNL SER A 5 ? UNP P15514 ? ? 'expression tag' 5 5 1 2RNL SER A 6 ? UNP P15514 ? ? 'expression tag' 6 6 1 2RNL GLY A 7 ? UNP P15514 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '20mM [U-100% 2H] TRIS; 100mM sodium chloride; 0.02% sodium azide; 10% [U-100% 2H] D2O; 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 900 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2RNL _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RNL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RNL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMR 6.1C 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 20030801 2 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0.4 3 Kobayashi,N. 'data analysis' KUJIRA 0.9820 4 Kobayashi,N. 'chemical shift assignment' KUJIRA 0.9820 5 Kobayashi,N. 'peak picking' KUJIRA 0.9820 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0.17 7 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.0.17 8 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RNL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RNL _struct.title 'Solution structure of the EGF-like domain from human Amphiregulin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RNL _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;AR, Colorectum cell-derived growth factor, EGF-like domain, CRDGF, Cytokine, Glycoprotein, Membrane, Polymorphism, Transmembrane, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 15 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 19 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 15 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 19 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 12 A CYS 25 1_555 ? ? ? ? ? ? ? 2.054 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 20 A CYS 36 1_555 ? ? ? ? ? ? ? 2.011 ? ? disulf3 disulf ? ? A CYS 38 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 38 A CYS 47 1_555 ? ? ? ? ? ? ? 2.004 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 24 ? ILE A 28 ? GLU A 24 ILE A 28 A 2 ALA A 33 ? LYS A 37 ? ALA A 33 LYS A 37 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 37 # _atom_sites.entry_id 2RNL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-20 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TRIS 20 mM '[U-100% 2H]' 1 'sodium chloride' 100 mM ? 1 'sodium azide' 0.02 % ? 1 D2O 10 % '[U-100% 2H]' 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -56.72 106.74 2 1 PHE A 19 ? ? -105.54 -65.33 3 1 GLN A 39 ? ? -62.19 -177.10 4 1 GLU A 45 ? ? -96.98 -65.21 5 1 CYS A 47 ? ? 74.47 41.67 6 2 SER A 3 ? ? -36.15 153.22 7 2 LYS A 8 ? ? -96.88 51.74 8 2 PHE A 19 ? ? -37.18 -72.47 9 2 GLN A 40 ? ? -37.37 -38.48 10 2 PHE A 43 ? ? -174.70 149.81 11 2 CYS A 47 ? ? 37.03 42.66 12 3 HIS A 30 ? ? -37.33 -28.49 13 3 GLU A 45 ? ? -100.43 -65.33 14 4 ALA A 14 ? ? -76.10 -74.96 15 4 GLN A 39 ? ? -58.33 -174.98 16 4 CYS A 47 ? ? 71.64 45.22 17 5 ALA A 14 ? ? -104.48 -71.60 18 5 PHE A 19 ? ? -100.13 -62.92 19 5 GLN A 39 ? ? -56.62 176.64 20 6 ALA A 14 ? ? -130.26 -59.07 21 6 PHE A 19 ? ? -97.90 -68.00 22 6 ILE A 21 ? ? -97.50 -61.93 23 6 GLN A 40 ? ? -38.29 -35.55 24 6 PHE A 43 ? ? -173.38 143.36 25 6 GLU A 45 ? ? -36.65 -39.68 26 6 CYS A 47 ? ? 72.82 43.40 27 7 SER A 2 ? ? -108.48 42.28 28 7 ILE A 21 ? ? -100.25 -67.67 29 7 HIS A 22 ? ? -111.84 77.93 30 7 GLN A 40 ? ? -39.34 -31.24 31 7 ARG A 46 ? ? 41.14 25.72 32 7 CYS A 47 ? ? 36.66 36.38 33 8 LYS A 9 ? ? -47.86 102.48 34 8 HIS A 30 ? ? -39.39 -31.88 35 9 SER A 3 ? ? 36.33 42.15 36 9 ALA A 14 ? ? -111.60 -72.96 37 9 ILE A 21 ? ? -93.74 -68.20 38 9 HIS A 22 ? ? -117.47 78.39 39 9 GLN A 39 ? ? -47.70 151.14 40 9 PHE A 43 ? ? -173.75 145.15 41 10 ALA A 14 ? ? -82.86 -73.15 42 10 GLN A 39 ? ? -54.78 -176.41 43 10 CYS A 47 ? ? 74.20 42.33 44 11 SER A 6 ? ? -174.32 114.53 45 11 LYS A 9 ? ? -49.69 176.63 46 11 ALA A 14 ? ? -65.99 -71.08 47 11 PHE A 19 ? ? -38.32 -70.51 48 11 GLN A 39 ? ? -53.75 -177.75 49 12 HIS A 30 ? ? -39.90 -38.70 50 12 CYS A 47 ? ? 74.83 54.89 51 13 SER A 5 ? ? -46.74 154.77 52 13 PHE A 19 ? ? -96.31 -65.87 53 13 CYS A 20 ? ? -67.43 84.44 54 13 GLU A 32 ? ? 34.59 40.21 55 13 GLN A 39 ? ? -58.64 -176.51 56 13 GLU A 45 ? ? -98.86 -63.61 57 13 CYS A 47 ? ? 72.46 40.94 58 14 PHE A 19 ? ? -99.39 -67.43 59 14 HIS A 30 ? ? -48.78 -19.11 60 14 GLN A 39 ? ? -56.91 176.96 61 14 GLU A 45 ? ? -100.94 -60.71 62 15 ALA A 14 ? ? -104.36 -63.49 63 15 CYS A 47 ? ? 74.87 43.15 64 16 SER A 5 ? ? 37.35 42.60 65 16 HIS A 30 ? ? -48.98 -19.21 66 16 GLU A 45 ? ? -101.43 -63.41 67 16 CYS A 47 ? ? 72.77 45.85 68 17 SER A 3 ? ? -174.41 114.42 69 17 PHE A 19 ? ? -95.92 -68.02 70 17 GLN A 39 ? ? -59.66 -178.10 71 17 GLU A 45 ? ? -94.72 -67.60 72 17 CYS A 47 ? ? 74.01 43.72 73 18 CYS A 12 ? ? -35.81 -34.94 74 18 PHE A 19 ? ? -90.85 -72.71 75 18 GLN A 39 ? ? -57.04 -177.57 76 18 CYS A 47 ? ? 70.63 42.93 77 19 GLU A 45 ? ? -102.46 -65.74 78 20 SER A 2 ? ? 38.81 42.14 79 20 ALA A 14 ? ? -106.01 -68.49 80 20 CYS A 47 ? ? -38.01 133.70 #