data_2ROB # _entry.id 2ROB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ROB pdb_00002rob 10.2210/pdb2rob/pdb RCSB RCSB150089 ? ? WWPDB D_1000150089 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2RO8 . unspecified PDB 2RO9 . unspecified PDB 2ROA . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2ROB _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-03-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ishida, H.' 1 'Huang, H.' 2 'Yamniuk, A.P.' 3 'Takaya, Y.' 4 'Vogel, H.J.' 5 # _citation.id primary _citation.title ;The solution structures of two soybean calmodulin isoforms provide a structural basis for their selective target activation properties ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 14619 _citation.page_last 14628 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18347016 _citation.pdbx_database_id_DOI 10.1074/jbc.M801398200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishida, H.' 1 ? primary 'Huang, H.' 2 ? primary 'Yamniuk, A.P.' 3 ? primary 'Takaya, Y.' 4 ? primary 'Vogel, H.J.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8140.080 1 ? ? 'C-terminal domain' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVR _entity_poly.pdbx_seq_one_letter_code_can DAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ALA n 1 3 GLU n 1 4 GLU n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 GLU n 1 9 ALA n 1 10 PHE n 1 11 LYS n 1 12 VAL n 1 13 PHE n 1 14 ASP n 1 15 LYS n 1 16 ASP n 1 17 GLN n 1 18 ASN n 1 19 GLY n 1 20 TYR n 1 21 ILE n 1 22 SER n 1 23 ALA n 1 24 SER n 1 25 GLU n 1 26 LEU n 1 27 ARG n 1 28 HIS n 1 29 VAL n 1 30 MET n 1 31 ILE n 1 32 ASN n 1 33 LEU n 1 34 GLY n 1 35 GLU n 1 36 LYS n 1 37 LEU n 1 38 THR n 1 39 ASP n 1 40 GLU n 1 41 GLU n 1 42 VAL n 1 43 GLU n 1 44 GLN n 1 45 MET n 1 46 ILE n 1 47 LYS n 1 48 GLU n 1 49 ALA n 1 50 ASP n 1 51 LEU n 1 52 ASP n 1 53 GLY n 1 54 ASP n 1 55 GLY n 1 56 GLN n 1 57 VAL n 1 58 ASN n 1 59 TYR n 1 60 GLU n 1 61 GLU n 1 62 PHE n 1 63 VAL n 1 64 LYS n 1 65 MET n 1 66 MET n 1 67 MET n 1 68 THR n 1 69 VAL n 1 70 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name soybean _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycine max' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3847 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-3d _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q39890_SOYBN _struct_ref.pdbx_db_accession Q39890 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVR _struct_ref.pdbx_align_begin 81 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ROB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q39890 _struct_ref_seq.db_align_beg 81 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 80 _struct_ref_seq.pdbx_auth_seq_align_end 149 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCACB' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CA)CO' 1 5 2 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY' 1 7 1 '3D C(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HBHA(CO)NH' 1 10 3 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] Calmodulin, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] Calmodulin, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1 mM Calmodulin, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2ROB _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2ROB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2ROB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2ROB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2ROB _struct.title 'Solution structure of calcium bound soybean calmodulin isoform 4 C-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ROB _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'soybean calmodulin, plant calmodulin, calmodulin isoform, target binding, target activation, Calcium, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 1 ? ASP A 14 ? ASP A 80 ASP A 93 1 ? 14 HELX_P HELX_P2 2 SER A 22 ? LEU A 33 ? SER A 101 LEU A 112 1 ? 12 HELX_P HELX_P3 3 THR A 38 ? ASP A 50 ? THR A 117 ASP A 129 1 ? 13 HELX_P HELX_P4 4 ASN A 58 ? ARG A 70 ? ASN A 137 ARG A 149 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 14 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 93 A CA 221 1_555 ? ? ? ? ? ? ? 2.599 ? ? metalc2 metalc ? ? A ASP 16 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 95 A CA 221 1_555 ? ? ? ? ? ? ? 2.622 ? ? metalc3 metalc ? ? A ASN 18 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 97 A CA 221 1_555 ? ? ? ? ? ? ? 2.611 ? ? metalc4 metalc ? ? A TYR 20 O ? ? ? 1_555 B CA . CA ? ? A TYR 99 A CA 221 1_555 ? ? ? ? ? ? ? 2.570 ? ? metalc5 metalc ? ? A GLU 25 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 104 A CA 221 1_555 ? ? ? ? ? ? ? 2.645 ? ? metalc6 metalc ? ? A GLU 25 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 104 A CA 221 1_555 ? ? ? ? ? ? ? 2.611 ? ? metalc7 metalc ? ? A ASP 50 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 129 A CA 234 1_555 ? ? ? ? ? ? ? 2.613 ? ? metalc8 metalc ? ? A ASP 52 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 131 A CA 234 1_555 ? ? ? ? ? ? ? 2.756 ? ? metalc9 metalc ? ? A ASP 52 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 131 A CA 234 1_555 ? ? ? ? ? ? ? 2.590 ? ? metalc10 metalc ? ? A ASP 54 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 234 1_555 ? ? ? ? ? ? ? 2.647 ? ? metalc11 metalc ? ? A ASP 54 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 133 A CA 234 1_555 ? ? ? ? ? ? ? 2.729 ? ? metalc12 metalc ? ? A GLN 56 O ? ? ? 1_555 C CA . CA ? ? A GLN 135 A CA 234 1_555 ? ? ? ? ? ? ? 2.578 ? ? metalc13 metalc ? ? A GLU 61 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 140 A CA 234 1_555 ? ? ? ? ? ? ? 2.603 ? ? metalc14 metalc ? ? A GLU 61 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 140 A CA 234 1_555 ? ? ? ? ? ? ? 2.583 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 221 ? 8 'BINDING SITE FOR RESIDUE CA A 221' AC2 Software A CA 234 ? 5 'BINDING SITE FOR RESIDUE CA A 234' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 PHE A 13 ? PHE A 92 . ? 1_555 ? 2 AC1 8 ASP A 14 ? ASP A 93 . ? 1_555 ? 3 AC1 8 LYS A 15 ? LYS A 94 . ? 1_555 ? 4 AC1 8 ASP A 16 ? ASP A 95 . ? 1_555 ? 5 AC1 8 ASN A 18 ? ASN A 97 . ? 1_555 ? 6 AC1 8 TYR A 20 ? TYR A 99 . ? 1_555 ? 7 AC1 8 ILE A 21 ? ILE A 100 . ? 1_555 ? 8 AC1 8 SER A 22 ? SER A 101 . ? 1_555 ? 9 AC2 5 ALA A 49 ? ALA A 128 . ? 1_555 ? 10 AC2 5 ASP A 50 ? ASP A 129 . ? 1_555 ? 11 AC2 5 LEU A 51 ? LEU A 130 . ? 1_555 ? 12 AC2 5 ASP A 52 ? ASP A 131 . ? 1_555 ? 13 AC2 5 ASN A 58 ? ASN A 137 . ? 1_555 ? # _atom_sites.entry_id 2ROB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 80 80 ASP ASP A . n A 1 2 ALA 2 81 81 ALA ALA A . n A 1 3 GLU 3 82 82 GLU GLU A . n A 1 4 GLU 4 83 83 GLU GLU A . n A 1 5 GLU 5 84 84 GLU GLU A . n A 1 6 LEU 6 85 85 LEU LEU A . n A 1 7 LYS 7 86 86 LYS LYS A . n A 1 8 GLU 8 87 87 GLU GLU A . n A 1 9 ALA 9 88 88 ALA ALA A . n A 1 10 PHE 10 89 89 PHE PHE A . n A 1 11 LYS 11 90 90 LYS LYS A . n A 1 12 VAL 12 91 91 VAL VAL A . n A 1 13 PHE 13 92 92 PHE PHE A . n A 1 14 ASP 14 93 93 ASP ASP A . n A 1 15 LYS 15 94 94 LYS LYS A . n A 1 16 ASP 16 95 95 ASP ASP A . n A 1 17 GLN 17 96 96 GLN GLN A . n A 1 18 ASN 18 97 97 ASN ASN A . n A 1 19 GLY 19 98 98 GLY GLY A . n A 1 20 TYR 20 99 99 TYR TYR A . n A 1 21 ILE 21 100 100 ILE ILE A . n A 1 22 SER 22 101 101 SER SER A . n A 1 23 ALA 23 102 102 ALA ALA A . n A 1 24 SER 24 103 103 SER SER A . n A 1 25 GLU 25 104 104 GLU GLU A . n A 1 26 LEU 26 105 105 LEU LEU A . n A 1 27 ARG 27 106 106 ARG ARG A . n A 1 28 HIS 28 107 107 HIS HIS A . n A 1 29 VAL 29 108 108 VAL VAL A . n A 1 30 MET 30 109 109 MET MET A . n A 1 31 ILE 31 110 110 ILE ILE A . n A 1 32 ASN 32 111 111 ASN ASN A . n A 1 33 LEU 33 112 112 LEU LEU A . n A 1 34 GLY 34 113 113 GLY GLY A . n A 1 35 GLU 35 114 114 GLU GLU A . n A 1 36 LYS 36 115 115 LYS LYS A . n A 1 37 LEU 37 116 116 LEU LEU A . n A 1 38 THR 38 117 117 THR THR A . n A 1 39 ASP 39 118 118 ASP ASP A . n A 1 40 GLU 40 119 119 GLU GLU A . n A 1 41 GLU 41 120 120 GLU GLU A . n A 1 42 VAL 42 121 121 VAL VAL A . n A 1 43 GLU 43 122 122 GLU GLU A . n A 1 44 GLN 44 123 123 GLN GLN A . n A 1 45 MET 45 124 124 MET MET A . n A 1 46 ILE 46 125 125 ILE ILE A . n A 1 47 LYS 47 126 126 LYS LYS A . n A 1 48 GLU 48 127 127 GLU GLU A . n A 1 49 ALA 49 128 128 ALA ALA A . n A 1 50 ASP 50 129 129 ASP ASP A . n A 1 51 LEU 51 130 130 LEU LEU A . n A 1 52 ASP 52 131 131 ASP ASP A . n A 1 53 GLY 53 132 132 GLY GLY A . n A 1 54 ASP 54 133 133 ASP ASP A . n A 1 55 GLY 55 134 134 GLY GLY A . n A 1 56 GLN 56 135 135 GLN GLN A . n A 1 57 VAL 57 136 136 VAL VAL A . n A 1 58 ASN 58 137 137 ASN ASN A . n A 1 59 TYR 59 138 138 TYR TYR A . n A 1 60 GLU 60 139 139 GLU GLU A . n A 1 61 GLU 61 140 140 GLU GLU A . n A 1 62 PHE 62 141 141 PHE PHE A . n A 1 63 VAL 63 142 142 VAL VAL A . n A 1 64 LYS 64 143 143 LYS LYS A . n A 1 65 MET 65 144 144 MET MET A . n A 1 66 MET 66 145 145 MET MET A . n A 1 67 MET 67 146 146 MET MET A . n A 1 68 THR 68 147 147 THR THR A . n A 1 69 VAL 69 148 148 VAL VAL A . n A 1 70 ARG 70 149 149 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 221 221 CA CA A . C 2 CA 1 234 234 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 14 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OD2 ? A ASP 16 ? A ASP 95 ? 1_555 131.2 ? 2 OD1 ? A ASP 14 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OD1 ? A ASN 18 ? A ASN 97 ? 1_555 58.1 ? 3 OD2 ? A ASP 16 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OD1 ? A ASN 18 ? A ASN 97 ? 1_555 130.9 ? 4 OD1 ? A ASP 14 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 O ? A TYR 20 ? A TYR 99 ? 1_555 78.9 ? 5 OD2 ? A ASP 16 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 O ? A TYR 20 ? A TYR 99 ? 1_555 149.3 ? 6 OD1 ? A ASN 18 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 O ? A TYR 20 ? A TYR 99 ? 1_555 53.9 ? 7 OD1 ? A ASP 14 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE1 ? A GLU 25 ? A GLU 104 ? 1_555 93.5 ? 8 OD2 ? A ASP 16 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE1 ? A GLU 25 ? A GLU 104 ? 1_555 91.1 ? 9 OD1 ? A ASN 18 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE1 ? A GLU 25 ? A GLU 104 ? 1_555 137.8 ? 10 O ? A TYR 20 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE1 ? A GLU 25 ? A GLU 104 ? 1_555 93.2 ? 11 OD1 ? A ASP 14 ? A ASP 93 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE2 ? A GLU 25 ? A GLU 104 ? 1_555 96.7 ? 12 OD2 ? A ASP 16 ? A ASP 95 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE2 ? A GLU 25 ? A GLU 104 ? 1_555 53.6 ? 13 OD1 ? A ASN 18 ? A ASN 97 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE2 ? A GLU 25 ? A GLU 104 ? 1_555 151.1 ? 14 O ? A TYR 20 ? A TYR 99 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE2 ? A GLU 25 ? A GLU 104 ? 1_555 141.2 ? 15 OE1 ? A GLU 25 ? A GLU 104 ? 1_555 CA ? B CA . ? A CA 221 ? 1_555 OE2 ? A GLU 25 ? A GLU 104 ? 1_555 48.3 ? 16 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 51.7 ? 17 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 97.5 ? 18 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 47.4 ? 19 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 53.4 ? 20 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 52.0 ? 21 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 86.4 ? 22 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 100.4 ? 23 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 82.4 ? 24 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 83.2 ? 25 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 47.1 ? 26 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 O ? A GLN 56 ? A GLN 135 ? 1_555 74.7 ? 27 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 O ? A GLN 56 ? A GLN 135 ? 1_555 109.5 ? 28 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 O ? A GLN 56 ? A GLN 135 ? 1_555 143.9 ? 29 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 O ? A GLN 56 ? A GLN 135 ? 1_555 60.3 ? 30 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 O ? A GLN 56 ? A GLN 135 ? 1_555 64.4 ? 31 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 65.0 ? 32 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 111.5 ? 33 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 137.6 ? 34 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 108.1 ? 35 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 136.0 ? 36 O ? A GLN 56 ? A GLN 135 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 71.7 ? 37 OD1 ? A ASP 50 ? A ASP 129 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 57.5 ? 38 OD1 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 74.7 ? 39 OD2 ? A ASP 52 ? A ASP 131 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 88.4 ? 40 OD1 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 109.1 ? 41 OD2 ? A ASP 54 ? A ASP 133 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 155.1 ? 42 O ? A GLN 56 ? A GLN 135 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 114.2 ? 43 OE1 ? A GLU 61 ? A GLU 140 ? 1_555 CA ? C CA . ? A CA 234 ? 1_555 OE2 ? A GLU 61 ? A GLU 140 ? 1_555 49.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Calmodulin 1 mM '[U-100% 13C; U-100% 15N]' 1 Calmodulin 1 mM '[U-100% 15N]' 2 Calmodulin 1 mM ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.51 2 2 O A MET 146 ? ? H A ARG 149 ? ? 1.53 3 2 H A ASP 95 ? ? OE2 A GLU 104 ? ? 1.55 4 2 O A PHE 141 ? ? H A MET 145 ? ? 1.57 5 2 O A GLU 140 ? ? H A MET 144 ? ? 1.58 6 3 H A THR 117 ? ? OE1 A GLU 120 ? ? 1.51 7 3 OD1 A ASN 97 ? ? H A TYR 99 ? ? 1.57 8 3 OD1 A ASN 137 ? ? H A GLU 140 ? ? 1.58 9 4 O A MET 146 ? ? H A ARG 149 ? ? 1.45 10 4 O A ASP 118 ? ? H A GLU 122 ? ? 1.50 11 5 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.49 12 5 H A ASP 95 ? ? OE2 A GLU 104 ? ? 1.56 13 5 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.58 14 6 OD2 A ASP 129 ? ? H A GLY 134 ? ? 1.44 15 6 O A PHE 141 ? ? H A MET 145 ? ? 1.49 16 6 O A GLU 140 ? ? H A MET 144 ? ? 1.53 17 6 H A ASP 95 ? ? OE2 A GLU 104 ? ? 1.56 18 6 O A ASN 137 ? ? H A PHE 141 ? ? 1.57 19 7 O A GLU 140 ? ? H A MET 144 ? ? 1.51 20 7 O A PHE 141 ? ? H A MET 145 ? ? 1.53 21 7 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.53 22 7 O A GLU 84 ? ? H A ALA 88 ? ? 1.59 23 8 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.51 24 8 H A ASP 95 ? ? OE2 A GLU 104 ? ? 1.57 25 8 O A PHE 141 ? ? H A MET 145 ? ? 1.57 26 8 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.57 27 8 O A MET 146 ? ? H A ARG 149 ? ? 1.59 28 9 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.33 29 9 OD1 A ASN 137 ? ? H A GLU 140 ? ? 1.47 30 9 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.56 31 10 O A PHE 141 ? ? H A MET 145 ? ? 1.48 32 10 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.53 33 10 O A ASP 118 ? ? H A GLU 122 ? ? 1.54 34 10 O A GLU 140 ? ? H A MET 144 ? ? 1.57 35 10 H A ASN 137 ? ? OE1 A GLU 140 ? ? 1.58 36 11 OD2 A ASP 129 ? ? H A GLY 134 ? ? 1.49 37 11 O A MET 124 ? ? H A ALA 128 ? ? 1.59 38 12 OD2 A ASP 129 ? ? H A GLY 134 ? ? 1.47 39 12 O A ASP 93 ? ? H A GLN 96 ? ? 1.53 40 12 OD1 A ASN 137 ? ? H A GLU 140 ? ? 1.57 41 13 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.34 42 13 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.45 43 13 OD1 A ASN 137 ? ? H A GLU 140 ? ? 1.46 44 13 O A PHE 141 ? ? H A MET 145 ? ? 1.55 45 13 O A GLU 140 ? ? H A MET 144 ? ? 1.59 46 14 HZ3 A LYS 90 ? ? HE22 A GLN 96 ? ? 1.29 47 14 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.52 48 14 O A ASP 118 ? ? H A GLU 122 ? ? 1.54 49 14 O A PHE 141 ? ? H A MET 145 ? ? 1.56 50 15 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.44 51 15 O A ASP 118 ? ? H A GLU 122 ? ? 1.56 52 15 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.58 53 15 O A MET 146 ? ? H A ARG 149 ? ? 1.60 54 16 HD22 A ASN 97 ? ? O A TYR 99 ? ? 1.50 55 16 O A LYS 143 ? ? HG1 A THR 147 ? ? 1.52 56 16 O A VAL 142 ? ? H A MET 146 ? ? 1.52 57 16 OD1 A ASP 133 ? ? H A GLN 135 ? ? 1.53 58 16 O A ASP 93 ? ? H A GLN 96 ? ? 1.55 59 16 O A PHE 141 ? ? H A MET 145 ? ? 1.56 60 16 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.58 61 17 OD2 A ASP 129 ? ? H A GLY 134 ? ? 1.48 62 18 OD2 A ASP 93 ? ? H A GLY 98 ? ? 1.41 63 18 OD2 A ASP 129 ? ? H A GLY 134 ? ? 1.46 64 18 O A MET 146 ? ? H A ARG 149 ? ? 1.47 65 18 O A GLU 140 ? ? H A MET 144 ? ? 1.54 66 18 O A GLU 83 ? ? H A GLU 87 ? ? 1.57 67 18 O A GLU 84 ? ? H A ALA 88 ? ? 1.58 68 18 H A ASP 95 ? ? OE2 A GLU 104 ? ? 1.58 69 19 OD2 A ASP 129 ? ? H A GLY 134 ? ? 1.45 70 19 O A PHE 141 ? ? H A MET 145 ? ? 1.52 71 19 O A GLU 140 ? ? H A MET 144 ? ? 1.56 72 19 O A ILE 125 ? ? H A ASP 129 ? ? 1.59 73 20 O A ASP 93 ? ? H A GLN 96 ? ? 1.43 74 20 HD22 A ASN 97 ? ? O A TYR 99 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 147 ? ? -61.41 -71.42 2 2 GLN A 96 ? ? 49.25 26.11 3 2 THR A 147 ? ? -47.99 -17.26 4 3 THR A 147 ? ? -58.32 -71.73 5 4 GLU A 83 ? ? -62.73 -70.70 6 4 THR A 147 ? ? -44.46 -14.57 7 5 THR A 147 ? ? -58.09 -72.77 8 6 GLU A 83 ? ? -64.12 -71.41 9 6 THR A 147 ? ? -45.35 -15.40 10 6 VAL A 148 ? ? -66.14 11.98 11 7 THR A 147 ? ? -58.85 -72.54 12 8 GLU A 83 ? ? -64.32 -70.60 13 8 THR A 147 ? ? -48.61 -15.40 14 9 ASP A 93 ? ? -69.52 87.30 15 9 THR A 147 ? ? -57.51 -72.13 16 11 THR A 147 ? ? -57.78 -72.63 17 12 GLU A 83 ? ? -53.24 -70.29 18 12 THR A 147 ? ? -60.72 -72.14 19 14 GLU A 83 ? ? -60.08 -71.00 20 14 THR A 147 ? ? -61.18 -71.48 21 15 GLU A 83 ? ? -68.76 -70.02 22 15 THR A 147 ? ? -47.60 -14.25 23 16 THR A 147 ? ? -55.44 -72.99 24 16 VAL A 148 ? ? -67.00 -70.90 25 17 THR A 147 ? ? -58.41 -71.70 26 18 GLN A 96 ? ? 37.99 32.31 27 18 THR A 147 ? ? -48.56 -17.21 28 19 ASP A 93 ? ? -69.61 59.24 29 19 ASP A 129 ? ? -61.98 93.69 30 20 GLU A 83 ? ? -58.93 -72.04 31 20 THR A 147 ? ? -46.15 -18.53 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #