data_2ROT # _entry.id 2ROT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ROT pdb_00002rot 10.2210/pdb2rot/pdb RCSB RCSB150106 ? ? WWPDB D_1000150106 ? ? BMRB 11043 ? ? # _pdbx_database_related.db_id 11043 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2ROT _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-04-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kutyshenko, N.P.' 1 'Prokhorov, D.A.' 2 'Timchenko, M.A.' 3 'Kudrevatykh, Y.A.' 4 'Gushchina, L.V.' 5 'Khristoforov, V.S.' 6 'Filimonov, V.V.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure and dynamics of the chimeric SH3 domains, SHH- and SHA-"Bergeracs". ; Biochim.Biophys.Acta 1794 1813 1822 2009 BBACAQ NE 0006-3002 0113 ? 19732853 10.1016/j.bbapap.2009.08.021 1 'Different folding transition states may result in the same native structure.' Nat.Struct.Biol. 3 874 880 1996 NSBIEW US 1072-8368 2024 ? 8836105 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kutyshenko, V.P.' 1 ? primary 'Prokhorov, D.A.' 2 ? primary 'Timchenko, M.A.' 3 ? primary 'Kudrevatykh, Y.A.' 4 ? primary 'Gushchina, L.V.' 5 ? primary 'Khristoforov, V.S.' 6 ? primary 'Filimonov, V.V.' 7 ? primary 'Uversky, V.N.' 8 ? 1 'Viguera, A.R.' 9 ? 1 'Serrano, L.' 10 ? 1 'Wilmanns, M.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Spectrin alpha chain, brain' _entity.formula_weight 8136.353 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ALPHA-SPECTRIN SH3 Domain' _entity.details 'INSERTION OF BETA SHEET INCLUDING 47-56 RESIDUES (KITVNGKTYE) BETWEEN 47-48 OF SH3-PWT (1SHG).' # _entity_name_com.entity_id 1 _entity_name_com.name 'Spectrin, non-erythroid alpha chain, Fodrin alpha chain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD _entity_poly.pdbx_seq_one_letter_code_can MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVKITVNGKTYERQGFVPAAYVKKLD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 GLU n 1 4 THR n 1 5 GLY n 1 6 LYS n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 TYR n 1 14 ASP n 1 15 TYR n 1 16 GLN n 1 17 GLU n 1 18 LYS n 1 19 SER n 1 20 PRO n 1 21 ARG n 1 22 GLU n 1 23 VAL n 1 24 THR n 1 25 MET n 1 26 LYS n 1 27 LYS n 1 28 GLY n 1 29 ASP n 1 30 ILE n 1 31 LEU n 1 32 THR n 1 33 LEU n 1 34 LEU n 1 35 ASN n 1 36 SER n 1 37 THR n 1 38 ASN n 1 39 LYS n 1 40 ASP n 1 41 TRP n 1 42 TRP n 1 43 LYS n 1 44 VAL n 1 45 GLU n 1 46 VAL n 1 47 LYS n 1 48 ILE n 1 49 THR n 1 50 VAL n 1 51 ASN n 1 52 GLY n 1 53 LYS n 1 54 THR n 1 55 TYR n 1 56 GLU n 1 57 ARG n 1 58 GLN n 1 59 GLY n 1 60 PHE n 1 61 VAL n 1 62 PRO n 1 63 ALA n 1 64 ALA n 1 65 TYR n 1 66 VAL n 1 67 LYS n 1 68 LYS n 1 69 LEU n 1 70 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Chicken _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SPTAN1, SPTA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gallus gallus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9031 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pBAT-4 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPTA2_CHICK _struct_ref.pdbx_db_accession P07751 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD _struct_ref.pdbx_align_begin 965 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ROT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P07751 _struct_ref_seq.db_align_beg 965 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1025 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ROT MET A 1 ? UNP P07751 ? ? 'initiating methionine' 1 1 1 2ROT LYS A 47 ? UNP P07751 ASN 1010 'SEE REMARK 999' 47 2 1 2ROT ILE A 48 ? UNP P07751 ? ? 'SEE REMARK 999' 48 3 1 2ROT THR A 49 ? UNP P07751 ? ? 'SEE REMARK 999' 49 4 1 2ROT VAL A 50 ? UNP P07751 ? ? 'SEE REMARK 999' 50 5 1 2ROT ASN A 51 ? UNP P07751 ? ? 'SEE REMARK 999' 51 6 1 2ROT GLY A 52 ? UNP P07751 ? ? 'SEE REMARK 999' 52 7 1 2ROT LYS A 53 ? UNP P07751 ? ? 'SEE REMARK 999' 53 8 1 2ROT THR A 54 ? UNP P07751 ? ? 'SEE REMARK 999' 54 9 1 2ROT TYR A 55 ? UNP P07751 ? ? 'SEE REMARK 999' 55 10 1 2ROT GLU A 56 ? UNP P07751 ASP 1011 'SEE REMARK 999' 56 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HCCH-TOCSY-ali' 1 5 1 '3D HCCH-TOCSY-aro' 1 6 1 '3D 1H-15N TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY-ali' 1 9 1 '3D 1H-13C NOESY-aro' 1 10 1 '3D HNCO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure 74 _pdbx_nmr_exptl_sample_conditions.pressure_units 3 _pdbx_nmr_exptl_sample_conditions.temperature 299 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;2.5mM [U-98% 13C; U-98% 15N] alpha-spectrin SHH, 90% H2O, 10% [U-99% 2H] D2O, 25mM [U-99% 2H] sodium acetate, 0.03% sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2ROT _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2ROT _pdbx_nmr_details.text ;The structure was determined using dihedral angles PHI and PSI predicted by program TALOS. H-bonds were determined on the basis of temperature dependence of NH chemical shifts ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2ROT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.24 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2ROT _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler, Wuthrich, Keller, Cornilescu, Delaglio, Bax, Bruker, Koradi, Billeter' 'structure solution' CYANA 2.1 1 'Guntert, Mumenthaler, Wuthrich, Keller, Cornilescu, Delaglio, Bax, Bruker, Koradi, Billeter' 'chemical shift assignment' CYANA 2.1 2 'Guntert, Mumenthaler, Wuthrich, Keller, Cornilescu, Delaglio, Bax, Bruker, Koradi, Billeter' 'dihedral angles calculation' CYANA 2.1 3 'Guntert, Mumenthaler, Wuthrich, Keller, Cornilescu, Delaglio, Bax, Bruker, Koradi, Billeter' processing CYANA 2.1 4 'Guntert, Mumenthaler, Wuthrich, Keller, Cornilescu, Delaglio, Bax, Bruker, Koradi, Billeter' 'data collection' CYANA 2.1 5 'Guntert, Mumenthaler, Wuthrich, Keller, Cornilescu, Delaglio, Bax, Bruker, Koradi, Billeter' refinement CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;SHH was constructed on the basis of alpa-spectrin wild type SH3-domain, containing 10 extra residues placed between 45th and 48th polypeptides' residues. Insertion of beta sheet includes 48-56 residues (KITVNGKTYE) between 45-48 of SH3-pwt (1SHG) ; _exptl.entry_id 2ROT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2ROT _struct.title 'Structure of chimeric variant of SH3 domain- SHH' _struct.pdbx_model_details ;SHH was constructed on the basis of alpa-spectrin wild type SH3-domain, containing 10 extra residues placed between 45th and 48th polypeptides' residues. Insertion of beta sheet includes 48-56 residues (KITVNGKTYE) between 45-48 of SH3-pwt (1SHG) ; _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ROT _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;SH3, chimeric protein, alpha-spectrin, Actin capping, Actin-binding, Calcium, Calmodulin-binding, Cytoplasm, Cytoskeleton, Phosphoprotein, SH3 domain, PROTEIN BINDING ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 53 ? PRO A 62 ? LYS A 53 PRO A 62 A 2 TRP A 41 ? VAL A 50 ? TRP A 41 VAL A 50 A 3 ILE A 30 ? ASN A 35 ? ILE A 30 ASN A 35 A 4 LEU A 8 ? ALA A 11 ? LEU A 8 ALA A 11 A 5 VAL A 66 ? LYS A 68 ? VAL A 66 LYS A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 61 ? O VAL A 61 N TRP A 42 ? N TRP A 42 A 2 3 O LYS A 43 ? O LYS A 43 N ASN A 35 ? N ASN A 35 A 3 4 O LEU A 31 ? O LEU A 31 N VAL A 9 ? N VAL A 9 A 4 5 N LEU A 10 ? N LEU A 10 O LYS A 67 ? O LYS A 67 # _atom_sites.entry_id 2ROT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ASP 70 70 70 ASP ASP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-28 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.sequence_details 'INSERTION OF BETA SHEET INCLUDING 47-56 RESIDUES (KITVNGKTYE) BETWEEN 47-48 OF SH3-PWT (1SHG).' _pdbx_entry_details.entry_id 2ROT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0041 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0011 _pdbx_nmr_ensemble_rms.entry_id 2ROT _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'alpha-spectrin SHH' 2.5 mM '[U-98% 13C; U-98% 15N]' 1 H2O 90 % ? 1 D2O 10 % '[U-99% 2H]' 1 'sodium acetate' 25 mM '[U-99% 2H]' 1 'sodium azide' 0.03 % ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2ROT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1156 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 268 _pdbx_nmr_constraints.NOE_long_range_total_count 402 _pdbx_nmr_constraints.NOE_medium_range_total_count 134 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 352 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -97.70 31.38 2 1 GLU A 3 ? ? 39.22 42.79 3 1 LYS A 27 ? ? -51.67 108.53 4 1 LEU A 33 ? ? -59.21 105.94 5 2 LEU A 33 ? ? -58.29 104.78 6 3 ASP A 2 ? ? -106.71 43.15 7 3 GLU A 3 ? ? -145.95 59.57 8 3 LYS A 6 ? ? -128.85 -74.77 9 3 GLU A 7 ? ? -179.46 85.99 10 3 LYS A 27 ? ? -51.38 105.77 11 4 ASP A 2 ? ? -113.78 52.63 12 4 GLU A 3 ? ? -54.17 -72.01 13 4 LEU A 33 ? ? -55.65 108.98 14 5 GLU A 3 ? ? -102.43 48.63 15 5 LYS A 6 ? ? -105.20 -71.76 16 6 LYS A 27 ? ? -51.48 105.94 17 6 LEU A 33 ? ? -55.34 109.80 18 7 ASP A 2 ? ? -108.49 63.66 19 7 LYS A 6 ? ? -131.31 -74.57 20 7 LYS A 27 ? ? -52.50 109.25 21 7 LEU A 33 ? ? -54.42 103.09 22 8 ASP A 2 ? ? -112.27 50.16 23 8 GLU A 7 ? ? -174.35 80.41 24 9 LYS A 6 ? ? -103.87 -73.47 25 9 ASP A 40 ? ? -101.58 -65.33 26 10 ASP A 2 ? ? -110.76 66.02 27 11 GLU A 3 ? ? -141.04 59.17 28 11 LYS A 6 ? ? -85.76 -78.01 29 11 GLU A 7 ? ? 178.02 89.59 30 12 ASP A 2 ? ? -109.40 49.14 31 12 LYS A 6 ? ? -102.37 -66.24 32 12 LYS A 27 ? ? -50.94 105.99 33 13 ASP A 2 ? ? -110.96 55.26 34 13 LYS A 6 ? ? -125.70 -75.15 35 13 LYS A 27 ? ? -50.93 105.79 36 14 LEU A 33 ? ? -58.39 102.69 37 15 GLU A 3 ? ? -58.76 -72.53 38 15 LYS A 6 ? ? -121.82 -65.86 39 15 LYS A 27 ? ? -49.46 105.84 40 15 LEU A 33 ? ? -59.13 107.50 41 16 ASP A 2 ? ? -107.25 40.18 42 16 GLU A 7 ? ? -172.85 64.68 43 16 LYS A 27 ? ? -51.36 105.84 44 18 ASP A 2 ? ? -116.04 61.27 45 18 LEU A 33 ? ? -51.82 106.15 46 19 ASP A 2 ? ? -103.81 57.80 47 19 LYS A 6 ? ? -98.35 -61.42 48 19 LYS A 27 ? ? -50.10 105.80 49 20 ASP A 2 ? ? -117.96 57.84 50 20 THR A 4 ? ? -178.01 -35.06 51 20 LYS A 6 ? ? -135.12 -73.56 52 20 LYS A 27 ? ? -51.33 105.87 #