data_2RPV # _entry.id 2RPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RPV pdb_00002rpv 10.2210/pdb2rpv/pdb RCSB RCSB150141 ? ? WWPDB D_1000150141 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 8 4 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RPV _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-10-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Saio, T.' 1 'Ogura, K.' 2 'Yokochi, M.' 3 'Kobashigawa, Y.' 4 'Inagaki, F.' 5 # _citation.id primary _citation.title 'Two-point anchoring of a lanthanide-binding peptide to a target protein enhances the paramagnetic anisotropic effect' _citation.journal_abbrev J.Biomol.Nmr _citation.journal_volume 44 _citation.page_first 157 _citation.page_last 166 _citation.year 2009 _citation.journal_id_ASTM JBNME9 _citation.country NE _citation.journal_id_ISSN 0925-2738 _citation.journal_id_CSD 0800 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19468839 _citation.pdbx_database_id_DOI 10.1007/s10858-009-9325-z # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Saio, T.' 1 ? primary 'Ogura, K.' 2 ? primary 'Yokochi, M.' 3 ? primary 'Kobashigawa, Y.' 4 ? primary 'Inagaki, F.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Immunoglobulin G-binding protein G' 8208.817 1 ? E38C L2GB ? 2 non-polymer syn 'LANTHANUM (III) ION' 138.905 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IgG-binding protein G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CYVDTNNDGAYEGDELSGTMEYKLILNGKTLKGETTTCAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can CYVDTNNDGAYEGDELSGTMEYKLILNGKTLKGETTTCAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'LANTHANUM (III) ION' _pdbx_entity_nonpoly.comp_id LA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 TYR n 1 3 VAL n 1 4 ASP n 1 5 THR n 1 6 ASN n 1 7 ASN n 1 8 ASP n 1 9 GLY n 1 10 ALA n 1 11 TYR n 1 12 GLU n 1 13 GLY n 1 14 ASP n 1 15 GLU n 1 16 LEU n 1 17 SER n 1 18 GLY n 1 19 THR n 1 20 MET n 1 21 GLU n 1 22 TYR n 1 23 LYS n 1 24 LEU n 1 25 ILE n 1 26 LEU n 1 27 ASN n 1 28 GLY n 1 29 LYS n 1 30 THR n 1 31 LEU n 1 32 LYS n 1 33 GLY n 1 34 GLU n 1 35 THR n 1 36 THR n 1 37 THR n 1 38 CYS n 1 39 ALA n 1 40 VAL n 1 41 ASP n 1 42 ALA n 1 43 ALA n 1 44 THR n 1 45 ALA n 1 46 GLU n 1 47 LYS n 1 48 VAL n 1 49 PHE n 1 50 LYS n 1 51 GLN n 1 52 TYR n 1 53 ALA n 1 54 ASN n 1 55 ASP n 1 56 ASN n 1 57 GLY n 1 58 VAL n 1 59 ASP n 1 60 GLY n 1 61 GLU n 1 62 TRP n 1 63 THR n 1 64 TYR n 1 65 ASP n 1 66 ASP n 1 67 ALA n 1 68 THR n 1 69 LYS n 1 70 THR n 1 71 PHE n 1 72 THR n 1 73 VAL n 1 74 THR n 1 75 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptococcus sp. group G' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1320 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pETDuet _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LA non-polymer . 'LANTHANUM (III) ION' ? 'La 3' 138.905 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 TYR 2 2 2 TYR TYR A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id LA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 76 _pdbx_nonpoly_scheme.auth_seq_num 75 _pdbx_nonpoly_scheme.pdb_mon_id LA _pdbx_nonpoly_scheme.auth_mon_id LA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2RPV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2RPV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RPV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RPV _struct.title 'Solution Structure of GB1 with LBT probe' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RPV _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text ;lanthanide binding peptide, GB1, LBT, paramagnetic effect, olivia, Cell wall, IgG-binding protein, Peptidoglycan-anchor, Secreted, IMMUNE SYSTEM ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPG1_STRSG _struct_ref.pdbx_db_accession P06654 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _struct_ref.pdbx_align_begin 227 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P06654 _struct_ref_seq.db_align_beg 227 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 282 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 20 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RPV CYS A 1 ? UNP P06654 ? ? 'SEE REMARK 999' 1 1 1 2RPV TYR A 2 ? UNP P06654 ? ? 'SEE REMARK 999' 2 2 1 2RPV VAL A 3 ? UNP P06654 ? ? 'SEE REMARK 999' 3 3 1 2RPV ASP A 4 ? UNP P06654 ? ? 'SEE REMARK 999' 4 4 1 2RPV THR A 5 ? UNP P06654 ? ? 'SEE REMARK 999' 5 5 1 2RPV ASN A 6 ? UNP P06654 ? ? 'SEE REMARK 999' 6 6 1 2RPV ASN A 7 ? UNP P06654 ? ? 'SEE REMARK 999' 7 7 1 2RPV ASP A 8 ? UNP P06654 ? ? 'SEE REMARK 999' 8 8 1 2RPV GLY A 9 ? UNP P06654 ? ? 'SEE REMARK 999' 9 9 1 2RPV ALA A 10 ? UNP P06654 ? ? 'SEE REMARK 999' 10 10 1 2RPV TYR A 11 ? UNP P06654 ? ? 'SEE REMARK 999' 11 11 1 2RPV GLU A 12 ? UNP P06654 ? ? 'SEE REMARK 999' 12 12 1 2RPV GLY A 13 ? UNP P06654 ? ? 'SEE REMARK 999' 13 13 1 2RPV ASP A 14 ? UNP P06654 ? ? 'SEE REMARK 999' 14 14 1 2RPV GLU A 15 ? UNP P06654 ? ? 'SEE REMARK 999' 15 15 1 2RPV LEU A 16 ? UNP P06654 ? ? 'SEE REMARK 999' 16 16 1 2RPV SER A 17 ? UNP P06654 ? ? 'SEE REMARK 999' 17 17 1 2RPV GLY A 18 ? UNP P06654 ? ? 'SEE REMARK 999' 18 18 1 2RPV THR A 19 ? UNP P06654 ? ? 'SEE REMARK 999' 19 19 1 2RPV MET A 20 ? UNP P06654 ASP 227 conflict 20 20 1 2RPV GLU A 21 ? UNP P06654 THR 228 conflict 21 21 1 2RPV CYS A 38 ? UNP P06654 GLU 245 'engineered mutation' 38 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 13 ? SER A 17 ? GLY A 13 SER A 17 5 ? 5 HELX_P HELX_P2 2 ASP A 41 ? GLY A 57 ? ASP A 41 GLY A 57 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 38 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 38 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.992 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 38 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 38 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 32 ? ALA A 39 ? LYS A 32 ALA A 39 A 2 MET A 20 ? ASN A 27 ? MET A 20 ASN A 27 A 3 THR A 70 ? THR A 74 ? THR A 70 THR A 74 A 4 GLU A 61 ? ASP A 65 ? GLU A 61 ASP A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 37 ? O THR A 37 N TYR A 22 ? N TYR A 22 A 2 3 N ILE A 25 ? N ILE A 25 O PHE A 71 ? O PHE A 71 A 3 4 O THR A 72 ? O THR A 72 N THR A 63 ? N THR A 63 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id LA _struct_site.pdbx_auth_seq_id 76 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE LA A 76' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 VAL A 3 ? VAL A 3 . ? 1_555 ? 2 AC1 5 ASP A 4 ? ASP A 4 . ? 1_555 ? 3 AC1 5 THR A 5 ? THR A 5 . ? 1_555 ? 4 AC1 5 ASN A 7 ? ASN A 7 . ? 1_555 ? 5 AC1 5 ASP A 8 ? ASP A 8 . ? 1_555 ? # _pdbx_entry_details.sequence_details ;N-TERMINAL RESIDUES 1-16 IS A PARAMAGNETIC LANTHANIDE TAG, AND RESIDUES 17-19 ARE LINKERS. ; _pdbx_entry_details.entry_id 2RPV _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASP 4 ? ? LA A LA 76 ? ? 1.32 2 1 CG A ASP 4 ? ? LA A LA 76 ? ? 1.55 3 1 OD2 A ASP 4 ? ? LA A LA 76 ? ? 1.84 4 2 OE1 A GLU 12 ? ? LA A LA 76 ? ? 1.85 5 2 OE2 A GLU 12 ? ? LA A LA 76 ? ? 2.08 6 2 CD A GLU 12 ? ? LA A LA 76 ? ? 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 12 ? ? -161.86 115.57 2 1 THR A 68 ? ? -142.27 14.76 3 1 LYS A 69 ? ? 39.62 62.77 4 2 ASN A 7 ? ? 82.06 29.82 5 2 GLU A 12 ? ? -164.36 113.54 6 2 LYS A 69 ? ? 39.95 56.33 7 3 THR A 35 ? ? 179.57 175.12 8 5 ASN A 7 ? ? 81.55 30.15 9 8 GLU A 12 ? ? -161.15 114.63 10 8 THR A 35 ? ? 179.93 174.16 11 9 GLU A 12 ? ? -161.19 114.80 12 9 THR A 68 ? ? -142.53 14.95 13 9 LYS A 69 ? ? 39.70 62.89 14 10 ASN A 7 ? ? 83.90 22.61 15 11 ASN A 7 ? ? 74.73 32.40 16 11 THR A 68 ? ? -140.94 14.03 17 11 LYS A 69 ? ? 39.71 53.89 18 12 GLU A 12 ? ? -160.73 114.79 19 13 ASN A 7 ? ? 81.71 30.28 20 13 GLU A 12 ? ? -163.83 114.25 21 13 LYS A 69 ? ? 39.95 51.06 22 14 ASN A 7 ? ? 79.94 30.24 23 14 GLU A 12 ? ? -163.07 114.80 24 14 THR A 68 ? ? -145.53 16.98 25 14 LYS A 69 ? ? 38.90 62.21 26 15 ASN A 7 ? ? 76.72 31.54 27 15 THR A 68 ? ? -140.60 13.69 28 16 ASN A 7 ? ? 79.80 30.71 29 17 ASN A 7 ? ? 75.58 30.48 30 17 LYS A 69 ? ? 39.79 62.17 31 18 GLU A 12 ? ? -165.15 113.55 32 18 LYS A 69 ? ? 39.76 57.41 33 19 ASN A 7 ? ? 73.60 32.77 34 19 GLU A 12 ? ? -161.29 114.81 35 19 THR A 35 ? ? -176.19 -179.53 36 19 LYS A 69 ? ? 39.82 53.93 37 20 ASN A 7 ? ? 79.13 31.45 38 20 LEU A 16 ? ? -105.56 43.10 39 20 THR A 35 ? ? 179.42 176.39 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RPV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 2 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RPV _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '0.8mM [U-99% 13C; U-99% 15N] L2GB, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component L2GB _pdbx_nmr_exptl_sample.concentration 0.8 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D HNCA' 1 9 1 '3D HNCAHA' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D 1H-15N NOESY' 1 13 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2RPV _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Masashi Yokochi' 'chemical shift assignment' Olivia 1.14.3 1 'Masashi Yokochi' 'peak picking' Olivia 1.14.3 2 'Masashi Yokochi' processing Olivia 1.14.3 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 ILE N N N N 110 ILE CA C N S 111 ILE C C N N 112 ILE O O N N 113 ILE CB C N S 114 ILE CG1 C N N 115 ILE CG2 C N N 116 ILE CD1 C N N 117 ILE OXT O N N 118 ILE H H N N 119 ILE H2 H N N 120 ILE HA H N N 121 ILE HB H N N 122 ILE HG12 H N N 123 ILE HG13 H N N 124 ILE HG21 H N N 125 ILE HG22 H N N 126 ILE HG23 H N N 127 ILE HD11 H N N 128 ILE HD12 H N N 129 ILE HD13 H N N 130 ILE HXT H N N 131 LA LA LA N N 132 LEU N N N N 133 LEU CA C N S 134 LEU C C N N 135 LEU O O N N 136 LEU CB C N N 137 LEU CG C N N 138 LEU CD1 C N N 139 LEU CD2 C N N 140 LEU OXT O N N 141 LEU H H N N 142 LEU H2 H N N 143 LEU HA H N N 144 LEU HB2 H N N 145 LEU HB3 H N N 146 LEU HG H N N 147 LEU HD11 H N N 148 LEU HD12 H N N 149 LEU HD13 H N N 150 LEU HD21 H N N 151 LEU HD22 H N N 152 LEU HD23 H N N 153 LEU HXT H N N 154 LYS N N N N 155 LYS CA C N S 156 LYS C C N N 157 LYS O O N N 158 LYS CB C N N 159 LYS CG C N N 160 LYS CD C N N 161 LYS CE C N N 162 LYS NZ N N N 163 LYS OXT O N N 164 LYS H H N N 165 LYS H2 H N N 166 LYS HA H N N 167 LYS HB2 H N N 168 LYS HB3 H N N 169 LYS HG2 H N N 170 LYS HG3 H N N 171 LYS HD2 H N N 172 LYS HD3 H N N 173 LYS HE2 H N N 174 LYS HE3 H N N 175 LYS HZ1 H N N 176 LYS HZ2 H N N 177 LYS HZ3 H N N 178 LYS HXT H N N 179 MET N N N N 180 MET CA C N S 181 MET C C N N 182 MET O O N N 183 MET CB C N N 184 MET CG C N N 185 MET SD S N N 186 MET CE C N N 187 MET OXT O N N 188 MET H H N N 189 MET H2 H N N 190 MET HA H N N 191 MET HB2 H N N 192 MET HB3 H N N 193 MET HG2 H N N 194 MET HG3 H N N 195 MET HE1 H N N 196 MET HE2 H N N 197 MET HE3 H N N 198 MET HXT H N N 199 PHE N N N N 200 PHE CA C N S 201 PHE C C N N 202 PHE O O N N 203 PHE CB C N N 204 PHE CG C Y N 205 PHE CD1 C Y N 206 PHE CD2 C Y N 207 PHE CE1 C Y N 208 PHE CE2 C Y N 209 PHE CZ C Y N 210 PHE OXT O N N 211 PHE H H N N 212 PHE H2 H N N 213 PHE HA H N N 214 PHE HB2 H N N 215 PHE HB3 H N N 216 PHE HD1 H N N 217 PHE HD2 H N N 218 PHE HE1 H N N 219 PHE HE2 H N N 220 PHE HZ H N N 221 PHE HXT H N N 222 SER N N N N 223 SER CA C N S 224 SER C C N N 225 SER O O N N 226 SER CB C N N 227 SER OG O N N 228 SER OXT O N N 229 SER H H N N 230 SER H2 H N N 231 SER HA H N N 232 SER HB2 H N N 233 SER HB3 H N N 234 SER HG H N N 235 SER HXT H N N 236 THR N N N N 237 THR CA C N S 238 THR C C N N 239 THR O O N N 240 THR CB C N R 241 THR OG1 O N N 242 THR CG2 C N N 243 THR OXT O N N 244 THR H H N N 245 THR H2 H N N 246 THR HA H N N 247 THR HB H N N 248 THR HG1 H N N 249 THR HG21 H N N 250 THR HG22 H N N 251 THR HG23 H N N 252 THR HXT H N N 253 TRP N N N N 254 TRP CA C N S 255 TRP C C N N 256 TRP O O N N 257 TRP CB C N N 258 TRP CG C Y N 259 TRP CD1 C Y N 260 TRP CD2 C Y N 261 TRP NE1 N Y N 262 TRP CE2 C Y N 263 TRP CE3 C Y N 264 TRP CZ2 C Y N 265 TRP CZ3 C Y N 266 TRP CH2 C Y N 267 TRP OXT O N N 268 TRP H H N N 269 TRP H2 H N N 270 TRP HA H N N 271 TRP HB2 H N N 272 TRP HB3 H N N 273 TRP HD1 H N N 274 TRP HE1 H N N 275 TRP HE3 H N N 276 TRP HZ2 H N N 277 TRP HZ3 H N N 278 TRP HH2 H N N 279 TRP HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 LYS N CA sing N N 145 LYS N H sing N N 146 LYS N H2 sing N N 147 LYS CA C sing N N 148 LYS CA CB sing N N 149 LYS CA HA sing N N 150 LYS C O doub N N 151 LYS C OXT sing N N 152 LYS CB CG sing N N 153 LYS CB HB2 sing N N 154 LYS CB HB3 sing N N 155 LYS CG CD sing N N 156 LYS CG HG2 sing N N 157 LYS CG HG3 sing N N 158 LYS CD CE sing N N 159 LYS CD HD2 sing N N 160 LYS CD HD3 sing N N 161 LYS CE NZ sing N N 162 LYS CE HE2 sing N N 163 LYS CE HE3 sing N N 164 LYS NZ HZ1 sing N N 165 LYS NZ HZ2 sing N N 166 LYS NZ HZ3 sing N N 167 LYS OXT HXT sing N N 168 MET N CA sing N N 169 MET N H sing N N 170 MET N H2 sing N N 171 MET CA C sing N N 172 MET CA CB sing N N 173 MET CA HA sing N N 174 MET C O doub N N 175 MET C OXT sing N N 176 MET CB CG sing N N 177 MET CB HB2 sing N N 178 MET CB HB3 sing N N 179 MET CG SD sing N N 180 MET CG HG2 sing N N 181 MET CG HG3 sing N N 182 MET SD CE sing N N 183 MET CE HE1 sing N N 184 MET CE HE2 sing N N 185 MET CE HE3 sing N N 186 MET OXT HXT sing N N 187 PHE N CA sing N N 188 PHE N H sing N N 189 PHE N H2 sing N N 190 PHE CA C sing N N 191 PHE CA CB sing N N 192 PHE CA HA sing N N 193 PHE C O doub N N 194 PHE C OXT sing N N 195 PHE CB CG sing N N 196 PHE CB HB2 sing N N 197 PHE CB HB3 sing N N 198 PHE CG CD1 doub Y N 199 PHE CG CD2 sing Y N 200 PHE CD1 CE1 sing Y N 201 PHE CD1 HD1 sing N N 202 PHE CD2 CE2 doub Y N 203 PHE CD2 HD2 sing N N 204 PHE CE1 CZ doub Y N 205 PHE CE1 HE1 sing N N 206 PHE CE2 CZ sing Y N 207 PHE CE2 HE2 sing N N 208 PHE CZ HZ sing N N 209 PHE OXT HXT sing N N 210 SER N CA sing N N 211 SER N H sing N N 212 SER N H2 sing N N 213 SER CA C sing N N 214 SER CA CB sing N N 215 SER CA HA sing N N 216 SER C O doub N N 217 SER C OXT sing N N 218 SER CB OG sing N N 219 SER CB HB2 sing N N 220 SER CB HB3 sing N N 221 SER OG HG sing N N 222 SER OXT HXT sing N N 223 THR N CA sing N N 224 THR N H sing N N 225 THR N H2 sing N N 226 THR CA C sing N N 227 THR CA CB sing N N 228 THR CA HA sing N N 229 THR C O doub N N 230 THR C OXT sing N N 231 THR CB OG1 sing N N 232 THR CB CG2 sing N N 233 THR CB HB sing N N 234 THR OG1 HG1 sing N N 235 THR CG2 HG21 sing N N 236 THR CG2 HG22 sing N N 237 THR CG2 HG23 sing N N 238 THR OXT HXT sing N N 239 TRP N CA sing N N 240 TRP N H sing N N 241 TRP N H2 sing N N 242 TRP CA C sing N N 243 TRP CA CB sing N N 244 TRP CA HA sing N N 245 TRP C O doub N N 246 TRP C OXT sing N N 247 TRP CB CG sing N N 248 TRP CB HB2 sing N N 249 TRP CB HB3 sing N N 250 TRP CG CD1 doub Y N 251 TRP CG CD2 sing Y N 252 TRP CD1 NE1 sing Y N 253 TRP CD1 HD1 sing N N 254 TRP CD2 CE2 doub Y N 255 TRP CD2 CE3 sing Y N 256 TRP NE1 CE2 sing Y N 257 TRP NE1 HE1 sing N N 258 TRP CE2 CZ2 sing Y N 259 TRP CE3 CZ3 doub Y N 260 TRP CE3 HE3 sing N N 261 TRP CZ2 CH2 doub Y N 262 TRP CZ2 HZ2 sing N N 263 TRP CZ3 CH2 sing Y N 264 TRP CZ3 HZ3 sing N N 265 TRP CH2 HH2 sing N N 266 TRP OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2RPV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H LA N O S # loop_