data_2RQC # _entry.id 2RQC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RQC pdb_00002rqc 10.2210/pdb2rqc/pdb RCSB RCSB150158 ? ? WWPDB D_1000150158 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2CPZ 'The same protein without RNA' unspecified TargetDB hss001001546.2 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RQC _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-04-09 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tsuda, K.' 1 'Kuwasako, K.' 2 'Takahashi, M.' 3 'Someya, T.' 4 'Muto, Y.' 5 'Inoue, M.' 6 'Kigawa, T.' 7 'Terada, T.' 8 'Shirouzu, M.' 9 'Yokoyama, S.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Structural basis for the sequence-specific RNA-recognition mechanism of human CUG-BP1 RRM3' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 37 _citation.page_first 5151 _citation.page_last 5166 _citation.year 2009 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19553194 _citation.pdbx_database_id_DOI 10.1093/nar/gkp546 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tsuda, K.' 1 ? primary 'Kuwasako, K.' 2 ? primary 'Takahashi, M.' 3 ? primary 'Someya, T.' 4 ? primary 'Inoue, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Kobayashi, N.' 7 ? primary 'Shirouzu, M.' 8 ? primary 'Kigawa, T.' 9 ? primary 'Tanaka, A.' 10 ? primary 'Sugano, S.' 11 ? primary 'Guntert, P.' 12 ? primary 'Muto, Y.' 13 ? primary 'Yokoyama, S.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CUG-BP- and ETR-3-like factor 1' 12264.778 1 ? ? 'RNA RECOGNITION MOTIF, RESIDUES 383-484' ? 2 polymer syn "5'-R(*UP*GP*UP*GP*UP*G)-3'" 1909.157 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;CELF-1, Bruno-like protein 2, RNA-binding protein BRUNOL-2, CUG triplet repeat RNA-binding protein 1, CUG-BP1, Deadenylation factor CUG-BP, 50 kDa nuclear polyadenylated RNA-binding protein, Embryo deadenylation element-binding protein homolog, EDEN-BP homolog ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSA QAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG ; ;GSSGSSGLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSA QAAIQSMNGFQIGMKRLKVQLKRSKNDSKSGPSSG ; A hss001001546.2 2 polyribonucleotide no no UGUGUG UGUGUG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LEU n 1 9 THR n 1 10 GLN n 1 11 GLN n 1 12 SER n 1 13 ILE n 1 14 GLY n 1 15 ALA n 1 16 ALA n 1 17 GLY n 1 18 SER n 1 19 GLN n 1 20 LYS n 1 21 GLU n 1 22 GLY n 1 23 PRO n 1 24 GLU n 1 25 GLY n 1 26 ALA n 1 27 ASN n 1 28 LEU n 1 29 PHE n 1 30 ILE n 1 31 TYR n 1 32 HIS n 1 33 LEU n 1 34 PRO n 1 35 GLN n 1 36 GLU n 1 37 PHE n 1 38 GLY n 1 39 ASP n 1 40 GLN n 1 41 ASP n 1 42 LEU n 1 43 LEU n 1 44 GLN n 1 45 MET n 1 46 PHE n 1 47 MET n 1 48 PRO n 1 49 PHE n 1 50 GLY n 1 51 ASN n 1 52 VAL n 1 53 VAL n 1 54 SER n 1 55 ALA n 1 56 LYS n 1 57 VAL n 1 58 PHE n 1 59 ILE n 1 60 ASP n 1 61 LYS n 1 62 GLN n 1 63 THR n 1 64 ASN n 1 65 LEU n 1 66 SER n 1 67 LYS n 1 68 CYS n 1 69 PHE n 1 70 GLY n 1 71 PHE n 1 72 VAL n 1 73 SER n 1 74 TYR n 1 75 ASP n 1 76 ASN n 1 77 PRO n 1 78 VAL n 1 79 SER n 1 80 ALA n 1 81 GLN n 1 82 ALA n 1 83 ALA n 1 84 ILE n 1 85 GLN n 1 86 SER n 1 87 MET n 1 88 ASN n 1 89 GLY n 1 90 PHE n 1 91 GLN n 1 92 ILE n 1 93 GLY n 1 94 MET n 1 95 LYS n 1 96 ARG n 1 97 LEU n 1 98 LYS n 1 99 VAL n 1 100 GLN n 1 101 LEU n 1 102 LYS n 1 103 ARG n 1 104 SER n 1 105 LYS n 1 106 ASN n 1 107 ASP n 1 108 SER n 1 109 LYS n 1 110 SER n 1 111 GLY n 1 112 PRO n 1 113 SER n 1 114 SER n 1 115 GLY n 2 1 U n 2 2 G n 2 3 U n 2 4 G n 2 5 U n 2 6 G n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CUGBP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'FREE PROTEIN SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector P040329-21 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'E. COLI - CELL-FREE PROTEIN SYNTHESIS' # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'RNA WAS PREPARED BY IN VITRO TRANSCRIPTION' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CELF1_HUMAN Q92879 1 ;LTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSM NGFQIGMKRLKVQLKRSKNDSK ; 383 ? 2 PDB 2RQC 2RQC 2 UGUGUG 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2RQC A 8 ? 109 ? Q92879 383 ? 484 ? 383 484 2 2 2RQC B 1 ? 6 ? 2RQC 491 ? 496 ? 491 496 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RQC GLY A 1 ? UNP Q92879 ? ? 'expression tag' 376 1 1 2RQC SER A 2 ? UNP Q92879 ? ? 'expression tag' 377 2 1 2RQC SER A 3 ? UNP Q92879 ? ? 'expression tag' 378 3 1 2RQC GLY A 4 ? UNP Q92879 ? ? 'expression tag' 379 4 1 2RQC SER A 5 ? UNP Q92879 ? ? 'expression tag' 380 5 1 2RQC SER A 6 ? UNP Q92879 ? ? 'expression tag' 381 6 1 2RQC GLY A 7 ? UNP Q92879 ? ? 'expression tag' 382 7 1 2RQC SER A 110 ? UNP Q92879 ? ? 'expression tag' 485 8 1 2RQC GLY A 111 ? UNP Q92879 ? ? 'expression tag' 486 9 1 2RQC PRO A 112 ? UNP Q92879 ? ? 'expression tag' 487 10 1 2RQC SER A 113 ? UNP Q92879 ? ? 'expression tag' 488 11 1 2RQC SER A 114 ? UNP Q92879 ? ? 'expression tag' 489 12 1 2RQC GLY A 115 ? UNP Q92879 ? ? 'expression tag' 490 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '2D 1H-1H NOESY' 1 4 2 '3D 1H-13C NOESY' 1 5 2 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.800 mM [U-100% 13C; U-100% 15N] CUG-BP- AND ETR-3-LIKE FACTOR 1-1, 0.800 mM RNA (5'-R(*UP*GP*UP*GP*UP*G)-3')-2, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.800 mM [U-100% 13C; U-100% 15N] CUG-BP- AND ETR-3-LIKE FACTOR 1-3, 0.800 mM RNA (5'-R(*UP*GP*UP*GP*UP*G)-3')-4, 100% D2O ; 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'BRUKER AVANCE' # _pdbx_nmr_refine.entry_id 2RQC _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing, RESTRAINTED MOLECULAR DYNAMICS, SIMULATED ANNEALING, ENERGY MINIMIZATION' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RQC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RQC _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 9 1 'Bruker Biospin' collection XwinNMR 3.5 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 20060702 3 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.0.4 4 'Kobayashi. N' 'data analysis' KUJIRA 0.9825 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RQC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RQC _struct.title 'Solution Structure of RNA-binding domain 3 of CUGBP1 in complex with RNA (UG)3' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RQC _struct_keywords.pdbx_keywords TRANSCRIPTION/RNA _struct_keywords.text ;RRM DOMAIN, RBD, PROTEIN-RNA COMPLEX, TRANSCRIPTION-RNA COMPLEX, STRUCTURAL GENOMICS, NPPSFA, NATIONAL PROJECT ON PROTEIN STRUCTURAL AND FUNCTIONAL ANALYSES, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, ACTIVATOR, ALTERNATIVE SPLICING, CYTOPLASM, MRNA PROCESSING, NUCLEUS, PHOSPHOPROTEIN, RNA-BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 38 ? MET A 47 ? GLY A 413 MET A 422 1 ? 10 HELX_P HELX_P2 2 PRO A 48 ? GLY A 50 ? PRO A 423 GLY A 425 5 ? 3 HELX_P HELX_P3 3 ASN A 76 ? ASN A 88 ? ASN A 451 ASN A 463 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 52 ? ILE A 59 ? VAL A 427 ILE A 434 A 2 SER A 66 ? TYR A 74 ? SER A 441 TYR A 449 A 3 ASN A 27 ? TYR A 31 ? ASN A 402 TYR A 406 A 4 LYS A 98 ? LEU A 101 ? LYS A 473 LEU A 476 B 1 GLN A 91 ? ILE A 92 ? GLN A 466 ILE A 467 B 2 LYS A 95 ? ARG A 96 ? LYS A 470 ARG A 471 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 53 ? N VAL A 428 O SER A 73 ? O SER A 448 A 2 3 O GLY A 70 ? O GLY A 445 N ILE A 30 ? N ILE A 405 A 3 4 N PHE A 29 ? N PHE A 404 O GLN A 100 ? O GLN A 475 B 1 2 N ILE A 92 ? N ILE A 467 O LYS A 95 ? O LYS A 470 # _atom_sites.entry_id 2RQC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 376 376 GLY GLY A . n A 1 2 SER 2 377 377 SER SER A . n A 1 3 SER 3 378 378 SER SER A . n A 1 4 GLY 4 379 379 GLY GLY A . n A 1 5 SER 5 380 380 SER SER A . n A 1 6 SER 6 381 381 SER SER A . n A 1 7 GLY 7 382 382 GLY GLY A . n A 1 8 LEU 8 383 383 LEU LEU A . n A 1 9 THR 9 384 384 THR THR A . n A 1 10 GLN 10 385 385 GLN GLN A . n A 1 11 GLN 11 386 386 GLN GLN A . n A 1 12 SER 12 387 387 SER SER A . n A 1 13 ILE 13 388 388 ILE ILE A . n A 1 14 GLY 14 389 389 GLY GLY A . n A 1 15 ALA 15 390 390 ALA ALA A . n A 1 16 ALA 16 391 391 ALA ALA A . n A 1 17 GLY 17 392 392 GLY GLY A . n A 1 18 SER 18 393 393 SER SER A . n A 1 19 GLN 19 394 394 GLN GLN A . n A 1 20 LYS 20 395 395 LYS LYS A . n A 1 21 GLU 21 396 396 GLU GLU A . n A 1 22 GLY 22 397 397 GLY GLY A . n A 1 23 PRO 23 398 398 PRO PRO A . n A 1 24 GLU 24 399 399 GLU GLU A . n A 1 25 GLY 25 400 400 GLY GLY A . n A 1 26 ALA 26 401 401 ALA ALA A . n A 1 27 ASN 27 402 402 ASN ASN A . n A 1 28 LEU 28 403 403 LEU LEU A . n A 1 29 PHE 29 404 404 PHE PHE A . n A 1 30 ILE 30 405 405 ILE ILE A . n A 1 31 TYR 31 406 406 TYR TYR A . n A 1 32 HIS 32 407 407 HIS HIS A . n A 1 33 LEU 33 408 408 LEU LEU A . n A 1 34 PRO 34 409 409 PRO PRO A . n A 1 35 GLN 35 410 410 GLN GLN A . n A 1 36 GLU 36 411 411 GLU GLU A . n A 1 37 PHE 37 412 412 PHE PHE A . n A 1 38 GLY 38 413 413 GLY GLY A . n A 1 39 ASP 39 414 414 ASP ASP A . n A 1 40 GLN 40 415 415 GLN GLN A . n A 1 41 ASP 41 416 416 ASP ASP A . n A 1 42 LEU 42 417 417 LEU LEU A . n A 1 43 LEU 43 418 418 LEU LEU A . n A 1 44 GLN 44 419 419 GLN GLN A . n A 1 45 MET 45 420 420 MET MET A . n A 1 46 PHE 46 421 421 PHE PHE A . n A 1 47 MET 47 422 422 MET MET A . n A 1 48 PRO 48 423 423 PRO PRO A . n A 1 49 PHE 49 424 424 PHE PHE A . n A 1 50 GLY 50 425 425 GLY GLY A . n A 1 51 ASN 51 426 426 ASN ASN A . n A 1 52 VAL 52 427 427 VAL VAL A . n A 1 53 VAL 53 428 428 VAL VAL A . n A 1 54 SER 54 429 429 SER SER A . n A 1 55 ALA 55 430 430 ALA ALA A . n A 1 56 LYS 56 431 431 LYS LYS A . n A 1 57 VAL 57 432 432 VAL VAL A . n A 1 58 PHE 58 433 433 PHE PHE A . n A 1 59 ILE 59 434 434 ILE ILE A . n A 1 60 ASP 60 435 435 ASP ASP A . n A 1 61 LYS 61 436 436 LYS LYS A . n A 1 62 GLN 62 437 437 GLN GLN A . n A 1 63 THR 63 438 438 THR THR A . n A 1 64 ASN 64 439 439 ASN ASN A . n A 1 65 LEU 65 440 440 LEU LEU A . n A 1 66 SER 66 441 441 SER SER A . n A 1 67 LYS 67 442 442 LYS LYS A . n A 1 68 CYS 68 443 443 CYS CYS A . n A 1 69 PHE 69 444 444 PHE PHE A . n A 1 70 GLY 70 445 445 GLY GLY A . n A 1 71 PHE 71 446 446 PHE PHE A . n A 1 72 VAL 72 447 447 VAL VAL A . n A 1 73 SER 73 448 448 SER SER A . n A 1 74 TYR 74 449 449 TYR TYR A . n A 1 75 ASP 75 450 450 ASP ASP A . n A 1 76 ASN 76 451 451 ASN ASN A . n A 1 77 PRO 77 452 452 PRO PRO A . n A 1 78 VAL 78 453 453 VAL VAL A . n A 1 79 SER 79 454 454 SER SER A . n A 1 80 ALA 80 455 455 ALA ALA A . n A 1 81 GLN 81 456 456 GLN GLN A . n A 1 82 ALA 82 457 457 ALA ALA A . n A 1 83 ALA 83 458 458 ALA ALA A . n A 1 84 ILE 84 459 459 ILE ILE A . n A 1 85 GLN 85 460 460 GLN GLN A . n A 1 86 SER 86 461 461 SER SER A . n A 1 87 MET 87 462 462 MET MET A . n A 1 88 ASN 88 463 463 ASN ASN A . n A 1 89 GLY 89 464 464 GLY GLY A . n A 1 90 PHE 90 465 465 PHE PHE A . n A 1 91 GLN 91 466 466 GLN GLN A . n A 1 92 ILE 92 467 467 ILE ILE A . n A 1 93 GLY 93 468 468 GLY GLY A . n A 1 94 MET 94 469 469 MET MET A . n A 1 95 LYS 95 470 470 LYS LYS A . n A 1 96 ARG 96 471 471 ARG ARG A . n A 1 97 LEU 97 472 472 LEU LEU A . n A 1 98 LYS 98 473 473 LYS LYS A . n A 1 99 VAL 99 474 474 VAL VAL A . n A 1 100 GLN 100 475 475 GLN GLN A . n A 1 101 LEU 101 476 476 LEU LEU A . n A 1 102 LYS 102 477 477 LYS LYS A . n A 1 103 ARG 103 478 478 ARG ARG A . n A 1 104 SER 104 479 479 SER SER A . n A 1 105 LYS 105 480 480 LYS LYS A . n A 1 106 ASN 106 481 481 ASN ASN A . n A 1 107 ASP 107 482 482 ASP ASP A . n A 1 108 SER 108 483 483 SER SER A . n A 1 109 LYS 109 484 484 LYS LYS A . n A 1 110 SER 110 485 485 SER SER A . n A 1 111 GLY 111 486 486 GLY GLY A . n A 1 112 PRO 112 487 487 PRO PRO A . n A 1 113 SER 113 488 488 SER SER A . n A 1 114 SER 114 489 489 SER SER A . n A 1 115 GLY 115 490 490 GLY GLY A . n B 2 1 U 1 491 491 U U B . n B 2 2 G 2 492 492 G G B . n B 2 3 U 3 493 493 U U B . n B 2 4 G 4 494 494 G G B . n B 2 5 U 5 495 495 U U B . n B 2 6 G 6 496 496 G G B . n # _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center RSGI _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-08-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'CUG-BP- AND ETR-3-LIKE FACTOR 1-1' 800 ? uM '[U-100% 13C; U-100% 15N]' 1 ;RNA (5'-R(*UP*GP*UP*GP*UP*G)-3')-2 ; 800 ? uM ? 1 'CUG-BP- AND ETR-3-LIKE FACTOR 1-3' 800 ? uM '[U-100% 13C; U-100% 15N]' 2 ;RNA (5'-R(*UP*GP*UP*GP*UP*G)-3')-4 ; 800 ? uM ? 2 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.58 108.50 6.08 0.70 N 2 1 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 114.21 108.50 5.71 0.70 N 3 2 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.05 108.50 5.55 0.70 N 4 2 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.95 108.50 5.45 0.70 N 5 3 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 114.42 108.50 5.92 0.70 N 6 4 NE A ARG 478 ? ? CZ A ARG 478 ? ? NH1 A ARG 478 ? ? 123.57 120.30 3.27 0.50 N 7 4 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.08 108.50 5.58 0.70 N 8 4 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 112.88 108.50 4.38 0.70 N 9 5 NE A ARG 478 ? ? CZ A ARG 478 ? ? NH1 A ARG 478 ? ? 123.54 120.30 3.24 0.50 N 10 5 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 112.74 108.50 4.24 0.70 N 11 5 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.18 108.50 4.68 0.70 N 12 6 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.84 108.50 5.34 0.70 N 13 6 "O4'" B G 496 ? ? "C1'" B G 496 ? ? N9 B G 496 ? ? 114.30 108.50 5.80 0.70 N 14 7 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 113.84 108.50 5.34 0.70 N 15 7 "O4'" B G 496 ? ? "C1'" B G 496 ? ? N9 B G 496 ? ? 112.96 108.50 4.46 0.70 N 16 8 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 113.76 108.50 5.26 0.70 N 17 9 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 114.08 108.50 5.58 0.70 N 18 10 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 113.21 108.50 4.71 0.70 N 19 10 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 115.37 108.50 6.87 0.70 N 20 11 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.98 108.50 6.48 0.70 N 21 11 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 114.62 108.50 6.12 0.70 N 22 12 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.70 108.50 5.20 0.70 N 23 13 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.86 108.50 5.36 0.70 N 24 13 "O4'" B G 496 ? ? "C1'" B G 496 ? ? N9 B G 496 ? ? 113.97 108.50 5.47 0.70 N 25 14 NE A ARG 478 ? ? CZ A ARG 478 ? ? NH1 A ARG 478 ? ? 123.40 120.30 3.10 0.50 N 26 14 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 113.27 108.50 4.77 0.70 N 27 14 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 115.63 108.50 7.13 0.70 N 28 15 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.50 108.50 6.00 0.70 N 29 16 C5 B U 491 ? ? C6 B U 491 ? ? N1 B U 491 ? ? 119.56 122.70 -3.14 0.50 N 30 16 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 113.65 108.50 5.15 0.70 N 31 16 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 114.35 108.50 5.85 0.70 N 32 17 C5 B U 491 ? ? C6 B U 491 ? ? N1 B U 491 ? ? 119.67 122.70 -3.03 0.50 N 33 17 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.07 108.50 5.57 0.70 N 34 17 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.90 108.50 5.40 0.70 N 35 18 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 113.71 108.50 5.21 0.70 N 36 18 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.49 108.50 4.99 0.70 N 37 19 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.06 108.50 5.56 0.70 N 38 19 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.76 108.50 5.26 0.70 N 39 20 NE A ARG 478 ? ? CZ A ARG 478 ? ? NH1 A ARG 478 ? ? 123.86 120.30 3.56 0.50 N 40 20 "O4'" B G 492 ? ? "C1'" B G 492 ? ? N9 B G 492 ? ? 114.16 108.50 5.66 0.70 N 41 20 "O4'" B U 495 ? ? "C1'" B U 495 ? ? N1 B U 495 ? ? 113.12 108.50 4.62 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 394 ? ? -157.55 7.59 2 1 HIS A 407 ? ? 84.06 23.95 3 1 MET A 469 ? ? -158.90 19.64 4 1 ASN A 481 ? ? -157.11 31.36 5 2 ALA A 390 ? ? 65.66 -27.74 6 2 LYS A 480 ? ? -83.37 37.63 7 2 SER A 485 ? ? 63.21 -160.85 8 2 SER A 488 ? ? -148.40 13.42 9 3 SER A 380 ? ? -141.28 -49.80 10 3 GLN A 385 ? ? 72.78 148.24 11 3 HIS A 407 ? ? 81.63 24.26 12 3 MET A 469 ? ? -83.21 30.27 13 3 SER A 479 ? ? -165.96 12.59 14 4 ALA A 390 ? ? -166.64 -29.32 15 4 LYS A 395 ? ? -67.55 89.22 16 4 HIS A 407 ? ? 88.20 25.05 17 4 ASP A 482 ? ? -159.90 -42.04 18 4 SER A 488 ? ? -73.15 24.81 19 5 LEU A 383 ? ? -153.92 14.52 20 5 ALA A 390 ? ? -150.97 12.29 21 5 LYS A 395 ? ? -55.35 107.74 22 5 GLN A 410 ? ? -68.99 0.36 23 5 ARG A 478 ? ? -74.67 37.50 24 5 ASP A 482 ? ? -161.44 -38.77 25 6 SER A 381 ? ? -164.51 -36.00 26 6 GLN A 394 ? ? -146.05 22.76 27 6 HIS A 407 ? ? 82.16 18.71 28 6 GLN A 410 ? ? -69.95 1.75 29 7 SER A 380 ? ? 69.90 -5.03 30 7 GLN A 394 ? ? -143.18 23.46 31 8 SER A 377 ? ? -154.44 29.42 32 8 SER A 387 ? ? -170.25 -171.08 33 8 ALA A 390 ? ? 68.95 -42.52 34 8 HIS A 407 ? ? 84.24 21.30 35 8 SER A 488 ? ? -165.21 -47.11 36 9 SER A 378 ? ? -146.40 13.38 37 9 LEU A 383 ? ? 58.08 -166.54 38 9 ASP A 482 ? ? -158.13 82.84 39 10 HIS A 407 ? ? 83.85 21.33 40 10 LYS A 480 ? ? -79.37 35.23 41 10 SER A 483 ? ? -144.66 -27.87 42 11 SER A 377 ? ? 65.67 -164.86 43 11 ALA A 390 ? ? 65.72 -40.84 44 11 LYS A 395 ? ? -65.20 98.10 45 11 HIS A 407 ? ? 84.80 25.45 46 11 MET A 469 ? ? -161.47 8.99 47 12 GLN A 394 ? ? -146.51 24.06 48 12 LYS A 395 ? ? -58.09 109.09 49 12 MET A 469 ? ? -169.02 -40.42 50 12 ASN A 481 ? ? 175.26 -25.10 51 13 MET A 469 ? ? -167.85 -40.98 52 13 LYS A 484 ? ? -136.77 -35.01 53 14 GLN A 386 ? ? -160.33 -46.93 54 14 ALA A 390 ? ? 65.76 -31.53 55 14 HIS A 407 ? ? 81.45 24.96 56 14 MET A 469 ? ? -168.57 -37.73 57 14 ASP A 482 ? ? -159.70 -43.23 58 14 SER A 483 ? ? -158.80 19.21 59 15 GLN A 394 ? ? -140.51 27.90 60 15 LYS A 395 ? ? -68.07 91.16 61 15 LYS A 436 ? ? 78.63 -17.95 62 15 MET A 469 ? ? -143.24 11.11 63 15 ARG A 478 ? ? -129.71 -154.60 64 17 HIS A 407 ? ? 78.45 31.47 65 18 HIS A 407 ? ? 89.42 20.45 66 18 GLN A 410 ? ? -69.34 1.34 67 18 MET A 469 ? ? -161.77 5.77 68 18 ASN A 481 ? ? -165.20 -38.38 69 18 LYS A 484 ? ? -155.69 -45.51 70 19 ARG A 478 ? ? 50.60 -124.82 71 19 ASP A 482 ? ? -151.63 1.79 72 19 SER A 488 ? ? 66.01 -9.49 73 20 ALA A 390 ? ? 65.46 -30.27 74 20 HIS A 407 ? ? 81.02 25.94 75 20 SER A 479 ? ? -162.89 -46.38 76 20 LYS A 484 ? ? 42.27 -130.79 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 U B 491 ? ? 0.085 'SIDE CHAIN' 2 1 U B 495 ? ? 0.102 'SIDE CHAIN' 3 1 G B 496 ? ? 0.058 'SIDE CHAIN' 4 2 G B 496 ? ? 0.078 'SIDE CHAIN' 5 3 U B 491 ? ? 0.083 'SIDE CHAIN' 6 3 G B 494 ? ? 0.073 'SIDE CHAIN' 7 3 U B 495 ? ? 0.110 'SIDE CHAIN' 8 3 G B 496 ? ? 0.052 'SIDE CHAIN' 9 4 U B 491 ? ? 0.101 'SIDE CHAIN' 10 4 G B 496 ? ? 0.052 'SIDE CHAIN' 11 5 U B 495 ? ? 0.152 'SIDE CHAIN' 12 5 G B 496 ? ? 0.055 'SIDE CHAIN' 13 6 G B 496 ? ? 0.064 'SIDE CHAIN' 14 7 G B 496 ? ? 0.056 'SIDE CHAIN' 15 8 G B 494 ? ? 0.052 'SIDE CHAIN' 16 8 G B 496 ? ? 0.064 'SIDE CHAIN' 17 9 U B 491 ? ? 0.062 'SIDE CHAIN' 18 9 U B 495 ? ? 0.056 'SIDE CHAIN' 19 9 G B 496 ? ? 0.050 'SIDE CHAIN' 20 10 U B 491 ? ? 0.068 'SIDE CHAIN' 21 10 U B 495 ? ? 0.103 'SIDE CHAIN' 22 11 U B 491 ? ? 0.088 'SIDE CHAIN' 23 11 G B 494 ? ? 0.062 'SIDE CHAIN' 24 11 G B 496 ? ? 0.057 'SIDE CHAIN' 25 12 U B 491 ? ? 0.059 'SIDE CHAIN' 26 12 G B 494 ? ? 0.080 'SIDE CHAIN' 27 12 G B 496 ? ? 0.056 'SIDE CHAIN' 28 13 U B 491 ? ? 0.077 'SIDE CHAIN' 29 13 G B 494 ? ? 0.058 'SIDE CHAIN' 30 14 U B 491 ? ? 0.074 'SIDE CHAIN' 31 14 G B 492 ? ? 0.056 'SIDE CHAIN' 32 14 U B 495 ? ? 0.076 'SIDE CHAIN' 33 14 G B 496 ? ? 0.061 'SIDE CHAIN' 34 15 U B 491 ? ? 0.082 'SIDE CHAIN' 35 15 U B 493 ? ? 0.060 'SIDE CHAIN' 36 15 G B 496 ? ? 0.076 'SIDE CHAIN' 37 16 U B 491 ? ? 0.100 'SIDE CHAIN' 38 16 U B 493 ? ? 0.097 'SIDE CHAIN' 39 16 U B 495 ? ? 0.063 'SIDE CHAIN' 40 17 U B 491 ? ? 0.097 'SIDE CHAIN' 41 17 U B 495 ? ? 0.091 'SIDE CHAIN' 42 18 U B 491 ? ? 0.098 'SIDE CHAIN' 43 18 U B 495 ? ? 0.060 'SIDE CHAIN' 44 19 U B 491 ? ? 0.084 'SIDE CHAIN' 45 20 U B 493 ? ? 0.076 'SIDE CHAIN' #