data_2RR0 # _entry.id 2RR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RR0 pdb_00002rr0 10.2210/pdb2rr0/pdb RCSB RCSB150182 ? ? WWPDB D_1000150182 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-10-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RR0 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-02-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1TOZ PDB 'human NOTCH-1 ligand binding region' unspecified 2JOA PDB 'the PDZ domains of human HtrA1 and HtrA3' unspecified 2RQZ PDB 'sugar modified epidermal growth factor-like repeat 12 of mouse Notch-1 receptor' unspecified 2RR2 PDB 'O-fucosylated epidermal growth factor-like repeat 12 of mouse Notch-1 receptor' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hosoguchi, K.' 1 'Shimizu, K.' 2 'Fujitani, N.' 3 'Nishimura, S.' 4 # _citation.id primary _citation.title ;Chemical Synthesis, Folding, and Structural Insights into O-Fucosylated Epidermal Growth Factor-like Repeat 12 of Mouse Notch-1 Receptor ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 132 _citation.page_first 14857 _citation.page_last 14865 _citation.year 2010 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20883017 _citation.pdbx_database_id_DOI 10.1021/ja105216u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hiruma-Shimizu, K.' 1 ? primary 'Hosoguchi, K.' 2 ? primary 'Liu, Y.' 3 ? primary 'Fujitani, N.' 4 ? primary 'Ohta, T.' 5 ? primary 'Hinou, H.' 6 ? primary 'Matsushita, T.' 7 ? primary 'Shimizu, H.' 8 ? primary 'Feizi, T.' 9 ? primary 'Nishimura, S.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Neurogenic locus notch homolog protein 1' _entity.formula_weight 4218.697 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'EXTRACELLULAR DOMAIN EGF-LIKE repeat 12' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Notch 1, Motch A, mT14, p300' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI _entity_poly.pdbx_seq_one_letter_code_can DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 VAL n 1 3 ASN n 1 4 GLU n 1 5 CYS n 1 6 ILE n 1 7 SER n 1 8 ASN n 1 9 PRO n 1 10 CYS n 1 11 GLN n 1 12 ASN n 1 13 ASP n 1 14 ALA n 1 15 THR n 1 16 CYS n 1 17 LEU n 1 18 ASP n 1 19 GLN n 1 20 ILE n 1 21 GLY n 1 22 GLU n 1 23 PHE n 1 24 GLN n 1 25 CYS n 1 26 ILE n 1 27 CYS n 1 28 MET n 1 29 PRO n 1 30 GLY n 1 31 TYR n 1 32 GLU n 1 33 GLY n 1 34 VAL n 1 35 TYR n 1 36 CYS n 1 37 GLU n 1 38 ILE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Mus musculus' _pdbx_entity_src_syn.organism_common_name MOUSE _pdbx_entity_src_syn.ncbi_taxonomy_id 10090 _pdbx_entity_src_syn.details 'synthetic peptide' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RR0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RR0 _struct.title 'Structure of epidermal growth factor-like repeat 12 of mouse Notch-1 receptor' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RR0 _struct_keywords.pdbx_keywords RECEPTOR _struct_keywords.text ;Notch, EGF-Like Domain, Activator, ANK repeat, Cell membrane, Developmental protein, Differentiation, Disulfide bond, Glycoprotein, Metal-binding, Notch signaling pathway, Nucleus, Phosphoprotein, Receptor, Transcription, Transcription regulation, Transmembrane ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NOTC1_MOUSE _struct_ref.pdbx_db_accession Q01705 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI _struct_ref.pdbx_align_begin 452 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 38 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01705 _struct_ref_seq.db_align_beg 452 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 489 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 38 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 5 A CYS 16 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 27 A CYS 36 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 16 ? CYS A 5 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 25 ? CYS A 10 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 27 ? CYS A 36 ? CYS A 27 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 15 ? ASP A 18 ? THR A 15 ASP A 18 A 2 PHE A 23 ? ILE A 26 ? PHE A 23 ILE A 26 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 15 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 15 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 26 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 26 # _pdbx_entry_details.entry_id 2RR0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? -155.90 -46.17 2 1 CYS A 5 ? ? -97.41 40.60 3 1 ASN A 8 ? ? 64.29 90.98 4 1 CYS A 10 ? ? -48.71 171.17 5 1 ASN A 12 ? ? -89.90 -89.01 6 1 ASP A 13 ? ? -150.19 35.33 7 1 LEU A 17 ? ? -161.23 89.67 8 1 ILE A 20 ? ? -143.34 -45.52 9 1 CYS A 27 ? ? -129.67 -164.38 10 1 PRO A 29 ? ? -50.53 89.66 11 1 CYS A 36 ? ? 60.41 90.16 12 1 GLU A 37 ? ? -177.00 42.90 13 2 ASN A 3 ? ? -59.78 174.26 14 2 CYS A 5 ? ? -144.94 19.31 15 2 SER A 7 ? ? -150.10 -42.41 16 2 ASN A 8 ? ? 68.40 88.97 17 2 CYS A 10 ? ? -56.71 -170.14 18 2 ASN A 12 ? ? -89.88 -91.15 19 2 ASP A 13 ? ? -150.12 31.42 20 2 LEU A 17 ? ? -158.02 77.64 21 2 GLN A 19 ? ? -150.07 -71.02 22 2 GLU A 22 ? ? -107.71 70.40 23 2 GLU A 32 ? ? -108.73 -169.35 24 2 CYS A 36 ? ? 60.98 91.87 25 2 GLU A 37 ? ? -177.36 42.60 26 3 ASN A 8 ? ? 53.94 97.55 27 3 CYS A 10 ? ? -56.55 -169.84 28 3 ASN A 12 ? ? -89.76 -145.88 29 3 GLN A 19 ? ? -126.92 -60.37 30 3 ILE A 20 ? ? -137.95 -63.47 31 3 CYS A 27 ? ? -129.10 -165.57 32 3 PRO A 29 ? ? -40.82 93.22 33 3 CYS A 36 ? ? 62.66 76.81 34 3 GLU A 37 ? ? -150.90 41.08 35 4 CYS A 5 ? ? -95.77 35.34 36 4 SER A 7 ? ? -144.76 15.67 37 4 ASN A 8 ? ? 58.98 112.31 38 4 CYS A 10 ? ? -63.04 -175.42 39 4 GLN A 19 ? ? -133.41 -65.74 40 4 ILE A 20 ? ? -150.08 -46.08 41 4 PRO A 29 ? ? -38.81 91.42 42 4 CYS A 36 ? ? 54.47 74.06 43 4 GLU A 37 ? ? -166.93 30.42 44 5 GLU A 4 ? ? -127.06 -71.55 45 5 ASN A 8 ? ? 61.62 97.36 46 5 CYS A 10 ? ? -55.85 175.76 47 5 ASN A 12 ? ? -89.76 -145.40 48 5 GLN A 19 ? ? -115.51 -74.57 49 5 CYS A 27 ? ? -126.93 -167.03 50 5 PRO A 29 ? ? -33.55 95.70 51 5 CYS A 36 ? ? 61.09 76.98 52 5 GLU A 37 ? ? -141.10 28.77 53 6 ASN A 8 ? ? 57.08 104.37 54 6 CYS A 10 ? ? -54.64 -178.05 55 6 ASN A 12 ? ? -89.81 -144.94 56 6 GLN A 19 ? ? -132.98 -54.30 57 6 ILE A 20 ? ? -149.42 -46.05 58 6 CYS A 27 ? ? -129.27 -169.72 59 6 PRO A 29 ? ? -39.63 90.85 60 6 CYS A 36 ? ? 60.65 92.77 61 6 GLU A 37 ? ? -171.00 40.54 62 7 ASN A 8 ? ? 62.76 95.76 63 7 CYS A 10 ? ? -58.85 -163.54 64 7 GLN A 11 ? ? -132.08 -45.11 65 7 ASN A 12 ? ? -89.83 -90.11 66 7 ASP A 13 ? ? -150.12 29.04 67 7 GLN A 19 ? ? -150.08 -65.41 68 7 ILE A 20 ? ? -150.16 -45.43 69 7 PRO A 29 ? ? -36.49 92.40 70 7 GLU A 32 ? ? -107.14 -164.93 71 7 CYS A 36 ? ? 60.33 81.77 72 7 GLU A 37 ? ? -175.18 49.66 73 8 ASN A 3 ? ? -151.41 -58.73 74 8 GLU A 4 ? ? -148.97 28.65 75 8 ASN A 8 ? ? 66.11 105.88 76 8 ASN A 12 ? ? -89.68 -143.39 77 8 GLN A 19 ? ? -122.91 -78.94 78 8 ILE A 20 ? ? -150.06 30.63 79 8 CYS A 27 ? ? -126.99 -165.36 80 8 PRO A 29 ? ? -41.96 103.01 81 8 GLU A 32 ? ? -105.29 -165.72 82 8 CYS A 36 ? ? 61.21 86.19 83 8 GLU A 37 ? ? -174.54 41.90 84 9 CYS A 5 ? ? -98.05 30.05 85 9 ASN A 8 ? ? 63.57 95.64 86 9 CYS A 10 ? ? -56.49 -173.47 87 9 GLN A 11 ? ? -106.55 -60.01 88 9 ASN A 12 ? ? -89.75 -147.18 89 9 LEU A 17 ? ? -154.43 72.38 90 9 GLN A 19 ? ? -122.65 -72.26 91 9 ILE A 20 ? ? -136.30 -66.72 92 9 CYS A 27 ? ? -128.04 -168.18 93 9 PRO A 29 ? ? -38.94 91.94 94 9 CYS A 36 ? ? 59.52 90.73 95 9 GLU A 37 ? ? -170.86 35.09 96 10 ASN A 8 ? ? 62.51 115.75 97 10 CYS A 10 ? ? -60.13 -165.97 98 10 GLN A 11 ? ? -145.12 -45.15 99 10 ASN A 12 ? ? -89.98 -88.08 100 10 ASP A 13 ? ? -150.27 30.19 101 10 THR A 15 ? ? -101.08 -165.37 102 10 LEU A 17 ? ? -160.71 100.66 103 10 GLN A 19 ? ? -147.22 -62.67 104 10 PRO A 29 ? ? -36.98 104.35 105 10 CYS A 36 ? ? 57.74 82.82 106 10 GLU A 37 ? ? -165.96 42.84 107 11 CYS A 5 ? ? -97.07 36.40 108 11 ASN A 8 ? ? 63.04 118.92 109 11 CYS A 10 ? ? -58.84 -164.51 110 11 GLN A 11 ? ? -132.15 -43.43 111 11 ASN A 12 ? ? -89.88 -88.42 112 11 ASP A 13 ? ? -150.24 27.28 113 11 GLN A 19 ? ? -150.07 -49.92 114 11 ILE A 20 ? ? -150.00 57.33 115 11 PRO A 29 ? ? -31.01 122.14 116 11 CYS A 36 ? ? 59.54 78.42 117 11 GLU A 37 ? ? -160.47 42.58 118 12 ASN A 3 ? ? -97.40 42.81 119 12 ASN A 8 ? ? 61.86 100.01 120 12 CYS A 10 ? ? -48.92 170.65 121 12 ASN A 12 ? ? -90.04 -91.86 122 12 ASP A 13 ? ? -150.28 36.37 123 12 LEU A 17 ? ? -166.69 79.81 124 12 GLN A 19 ? ? -144.42 -82.06 125 12 CYS A 27 ? ? -128.38 -158.27 126 12 PRO A 29 ? ? -30.26 115.45 127 12 VAL A 34 ? ? -138.36 -45.31 128 12 CYS A 36 ? ? 59.41 85.41 129 12 GLU A 37 ? ? -175.32 34.23 130 13 GLU A 4 ? ? -143.16 -48.81 131 13 ASN A 8 ? ? 61.18 118.15 132 13 CYS A 10 ? ? -57.91 -166.61 133 13 GLN A 11 ? ? -135.05 -42.01 134 13 ASN A 12 ? ? -89.95 -88.90 135 13 ASP A 13 ? ? -150.12 43.13 136 13 GLN A 19 ? ? -125.40 -68.26 137 13 CYS A 27 ? ? -119.75 -168.27 138 13 PRO A 29 ? ? -34.93 97.49 139 13 CYS A 36 ? ? 60.79 91.74 140 13 GLU A 37 ? ? -169.73 33.44 141 14 CYS A 5 ? ? -97.84 30.02 142 14 ASN A 8 ? ? 61.83 91.02 143 14 CYS A 10 ? ? -45.95 164.26 144 14 ASN A 12 ? ? -89.83 -94.14 145 14 ASP A 13 ? ? -150.24 41.07 146 14 ILE A 20 ? ? -150.05 49.64 147 14 PRO A 29 ? ? -48.17 85.66 148 14 CYS A 36 ? ? 60.44 90.15 149 14 GLU A 37 ? ? 176.52 33.57 150 15 VAL A 2 ? ? -97.74 35.10 151 15 ASN A 3 ? ? 59.20 107.41 152 15 ASN A 8 ? ? 54.87 101.75 153 15 CYS A 10 ? ? -56.23 -171.07 154 15 ASN A 12 ? ? -89.65 -145.47 155 15 LEU A 17 ? ? -163.31 78.43 156 15 GLN A 19 ? ? -97.57 -69.60 157 15 ILE A 20 ? ? -140.28 -42.80 158 15 PRO A 29 ? ? -38.96 121.65 159 15 CYS A 36 ? ? 60.83 86.31 160 15 GLU A 37 ? ? -177.11 34.02 161 16 ASN A 8 ? ? 63.40 97.88 162 16 CYS A 10 ? ? -57.64 -169.69 163 16 ASN A 12 ? ? -89.77 -141.63 164 16 ASP A 13 ? ? -93.00 38.57 165 16 GLN A 19 ? ? -147.55 -65.97 166 16 ILE A 20 ? ? -139.44 -54.38 167 16 CYS A 27 ? ? -128.75 -167.57 168 16 PRO A 29 ? ? -38.81 98.46 169 16 CYS A 36 ? ? 60.26 85.27 170 16 GLU A 37 ? ? -158.72 37.23 171 17 ASN A 3 ? ? -171.51 80.63 172 17 ASN A 8 ? ? 60.12 103.48 173 17 CYS A 10 ? ? -58.01 -165.81 174 17 GLN A 11 ? ? -134.64 -43.32 175 17 ASN A 12 ? ? -89.64 -86.36 176 17 ASP A 13 ? ? -150.13 27.93 177 17 GLN A 19 ? ? -150.26 25.42 178 17 ILE A 20 ? ? -150.11 35.95 179 17 CYS A 27 ? ? -115.65 -166.22 180 17 PRO A 29 ? ? -50.79 93.77 181 17 GLU A 32 ? ? -107.64 -165.52 182 17 CYS A 36 ? ? 56.64 80.51 183 17 GLU A 37 ? ? -159.46 44.48 184 18 ASN A 3 ? ? 60.55 -174.35 185 18 GLU A 4 ? ? -123.93 -61.58 186 18 CYS A 5 ? ? -96.49 40.89 187 18 ASN A 8 ? ? 59.05 109.46 188 18 CYS A 10 ? ? -57.87 -166.70 189 18 ASN A 12 ? ? -89.80 -88.69 190 18 ASP A 13 ? ? -150.19 29.79 191 18 GLN A 19 ? ? -124.17 -73.97 192 18 CYS A 27 ? ? -124.32 -164.72 193 18 PRO A 29 ? ? -41.51 97.83 194 18 CYS A 36 ? ? 60.37 82.81 195 18 GLU A 37 ? ? -172.15 32.94 196 19 ASN A 8 ? ? 60.87 115.17 197 19 CYS A 10 ? ? -50.59 174.98 198 19 ASN A 12 ? ? -89.98 -90.33 199 19 ASP A 13 ? ? -150.29 33.28 200 19 GLN A 19 ? ? -129.49 -75.97 201 19 CYS A 27 ? ? -129.14 -165.54 202 19 PRO A 29 ? ? -41.28 103.08 203 20 ASN A 3 ? ? -74.09 -168.56 204 20 ASN A 8 ? ? 62.03 91.45 205 20 CYS A 10 ? ? -57.45 -169.41 206 20 ASN A 12 ? ? -89.86 -146.42 207 20 ASP A 13 ? ? -89.85 48.41 208 20 GLN A 19 ? ? -148.24 -67.79 209 20 ILE A 20 ? ? -135.50 -45.31 210 20 CYS A 27 ? ? -126.61 -167.84 211 20 PRO A 29 ? ? -38.13 92.16 212 20 CYS A 36 ? ? 61.19 81.48 213 20 GLU A 37 ? ? -160.52 39.69 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RR0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RR0 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.75mM NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1; 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.75mM NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1; 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1-1' 0.75 ? mM ? 1 'NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1-2' 0.75 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D 1H-1H TOCSY' 1 4 2 '2D 1H-1H TOCSY' # _pdbx_nmr_details.entry_id 2RR0 _pdbx_nmr_details.text 'The structure was determined using a combination NOE and D2O exchange experiment.' # _pdbx_nmr_refine.entry_id 2RR0 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors ? _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 1.1 _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 ILE N N N N 110 ILE CA C N S 111 ILE C C N N 112 ILE O O N N 113 ILE CB C N S 114 ILE CG1 C N N 115 ILE CG2 C N N 116 ILE CD1 C N N 117 ILE OXT O N N 118 ILE H H N N 119 ILE H2 H N N 120 ILE HA H N N 121 ILE HB H N N 122 ILE HG12 H N N 123 ILE HG13 H N N 124 ILE HG21 H N N 125 ILE HG22 H N N 126 ILE HG23 H N N 127 ILE HD11 H N N 128 ILE HD12 H N N 129 ILE HD13 H N N 130 ILE HXT H N N 131 LEU N N N N 132 LEU CA C N S 133 LEU C C N N 134 LEU O O N N 135 LEU CB C N N 136 LEU CG C N N 137 LEU CD1 C N N 138 LEU CD2 C N N 139 LEU OXT O N N 140 LEU H H N N 141 LEU H2 H N N 142 LEU HA H N N 143 LEU HB2 H N N 144 LEU HB3 H N N 145 LEU HG H N N 146 LEU HD11 H N N 147 LEU HD12 H N N 148 LEU HD13 H N N 149 LEU HD21 H N N 150 LEU HD22 H N N 151 LEU HD23 H N N 152 LEU HXT H N N 153 MET N N N N 154 MET CA C N S 155 MET C C N N 156 MET O O N N 157 MET CB C N N 158 MET CG C N N 159 MET SD S N N 160 MET CE C N N 161 MET OXT O N N 162 MET H H N N 163 MET H2 H N N 164 MET HA H N N 165 MET HB2 H N N 166 MET HB3 H N N 167 MET HG2 H N N 168 MET HG3 H N N 169 MET HE1 H N N 170 MET HE2 H N N 171 MET HE3 H N N 172 MET HXT H N N 173 PHE N N N N 174 PHE CA C N S 175 PHE C C N N 176 PHE O O N N 177 PHE CB C N N 178 PHE CG C Y N 179 PHE CD1 C Y N 180 PHE CD2 C Y N 181 PHE CE1 C Y N 182 PHE CE2 C Y N 183 PHE CZ C Y N 184 PHE OXT O N N 185 PHE H H N N 186 PHE H2 H N N 187 PHE HA H N N 188 PHE HB2 H N N 189 PHE HB3 H N N 190 PHE HD1 H N N 191 PHE HD2 H N N 192 PHE HE1 H N N 193 PHE HE2 H N N 194 PHE HZ H N N 195 PHE HXT H N N 196 PRO N N N N 197 PRO CA C N S 198 PRO C C N N 199 PRO O O N N 200 PRO CB C N N 201 PRO CG C N N 202 PRO CD C N N 203 PRO OXT O N N 204 PRO H H N N 205 PRO HA H N N 206 PRO HB2 H N N 207 PRO HB3 H N N 208 PRO HG2 H N N 209 PRO HG3 H N N 210 PRO HD2 H N N 211 PRO HD3 H N N 212 PRO HXT H N N 213 SER N N N N 214 SER CA C N S 215 SER C C N N 216 SER O O N N 217 SER CB C N N 218 SER OG O N N 219 SER OXT O N N 220 SER H H N N 221 SER H2 H N N 222 SER HA H N N 223 SER HB2 H N N 224 SER HB3 H N N 225 SER HG H N N 226 SER HXT H N N 227 THR N N N N 228 THR CA C N S 229 THR C C N N 230 THR O O N N 231 THR CB C N R 232 THR OG1 O N N 233 THR CG2 C N N 234 THR OXT O N N 235 THR H H N N 236 THR H2 H N N 237 THR HA H N N 238 THR HB H N N 239 THR HG1 H N N 240 THR HG21 H N N 241 THR HG22 H N N 242 THR HG23 H N N 243 THR HXT H N N 244 TYR N N N N 245 TYR CA C N S 246 TYR C C N N 247 TYR O O N N 248 TYR CB C N N 249 TYR CG C Y N 250 TYR CD1 C Y N 251 TYR CD2 C Y N 252 TYR CE1 C Y N 253 TYR CE2 C Y N 254 TYR CZ C Y N 255 TYR OH O N N 256 TYR OXT O N N 257 TYR H H N N 258 TYR H2 H N N 259 TYR HA H N N 260 TYR HB2 H N N 261 TYR HB3 H N N 262 TYR HD1 H N N 263 TYR HD2 H N N 264 TYR HE1 H N N 265 TYR HE2 H N N 266 TYR HH H N N 267 TYR HXT H N N 268 VAL N N N N 269 VAL CA C N S 270 VAL C C N N 271 VAL O O N N 272 VAL CB C N N 273 VAL CG1 C N N 274 VAL CG2 C N N 275 VAL OXT O N N 276 VAL H H N N 277 VAL H2 H N N 278 VAL HA H N N 279 VAL HB H N N 280 VAL HG11 H N N 281 VAL HG12 H N N 282 VAL HG13 H N N 283 VAL HG21 H N N 284 VAL HG22 H N N 285 VAL HG23 H N N 286 VAL HXT H N N 287 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 ILE N CA sing N N 103 ILE N H sing N N 104 ILE N H2 sing N N 105 ILE CA C sing N N 106 ILE CA CB sing N N 107 ILE CA HA sing N N 108 ILE C O doub N N 109 ILE C OXT sing N N 110 ILE CB CG1 sing N N 111 ILE CB CG2 sing N N 112 ILE CB HB sing N N 113 ILE CG1 CD1 sing N N 114 ILE CG1 HG12 sing N N 115 ILE CG1 HG13 sing N N 116 ILE CG2 HG21 sing N N 117 ILE CG2 HG22 sing N N 118 ILE CG2 HG23 sing N N 119 ILE CD1 HD11 sing N N 120 ILE CD1 HD12 sing N N 121 ILE CD1 HD13 sing N N 122 ILE OXT HXT sing N N 123 LEU N CA sing N N 124 LEU N H sing N N 125 LEU N H2 sing N N 126 LEU CA C sing N N 127 LEU CA CB sing N N 128 LEU CA HA sing N N 129 LEU C O doub N N 130 LEU C OXT sing N N 131 LEU CB CG sing N N 132 LEU CB HB2 sing N N 133 LEU CB HB3 sing N N 134 LEU CG CD1 sing N N 135 LEU CG CD2 sing N N 136 LEU CG HG sing N N 137 LEU CD1 HD11 sing N N 138 LEU CD1 HD12 sing N N 139 LEU CD1 HD13 sing N N 140 LEU CD2 HD21 sing N N 141 LEU CD2 HD22 sing N N 142 LEU CD2 HD23 sing N N 143 LEU OXT HXT sing N N 144 MET N CA sing N N 145 MET N H sing N N 146 MET N H2 sing N N 147 MET CA C sing N N 148 MET CA CB sing N N 149 MET CA HA sing N N 150 MET C O doub N N 151 MET C OXT sing N N 152 MET CB CG sing N N 153 MET CB HB2 sing N N 154 MET CB HB3 sing N N 155 MET CG SD sing N N 156 MET CG HG2 sing N N 157 MET CG HG3 sing N N 158 MET SD CE sing N N 159 MET CE HE1 sing N N 160 MET CE HE2 sing N N 161 MET CE HE3 sing N N 162 MET OXT HXT sing N N 163 PHE N CA sing N N 164 PHE N H sing N N 165 PHE N H2 sing N N 166 PHE CA C sing N N 167 PHE CA CB sing N N 168 PHE CA HA sing N N 169 PHE C O doub N N 170 PHE C OXT sing N N 171 PHE CB CG sing N N 172 PHE CB HB2 sing N N 173 PHE CB HB3 sing N N 174 PHE CG CD1 doub Y N 175 PHE CG CD2 sing Y N 176 PHE CD1 CE1 sing Y N 177 PHE CD1 HD1 sing N N 178 PHE CD2 CE2 doub Y N 179 PHE CD2 HD2 sing N N 180 PHE CE1 CZ doub Y N 181 PHE CE1 HE1 sing N N 182 PHE CE2 CZ sing Y N 183 PHE CE2 HE2 sing N N 184 PHE CZ HZ sing N N 185 PHE OXT HXT sing N N 186 PRO N CA sing N N 187 PRO N CD sing N N 188 PRO N H sing N N 189 PRO CA C sing N N 190 PRO CA CB sing N N 191 PRO CA HA sing N N 192 PRO C O doub N N 193 PRO C OXT sing N N 194 PRO CB CG sing N N 195 PRO CB HB2 sing N N 196 PRO CB HB3 sing N N 197 PRO CG CD sing N N 198 PRO CG HG2 sing N N 199 PRO CG HG3 sing N N 200 PRO CD HD2 sing N N 201 PRO CD HD3 sing N N 202 PRO OXT HXT sing N N 203 SER N CA sing N N 204 SER N H sing N N 205 SER N H2 sing N N 206 SER CA C sing N N 207 SER CA CB sing N N 208 SER CA HA sing N N 209 SER C O doub N N 210 SER C OXT sing N N 211 SER CB OG sing N N 212 SER CB HB2 sing N N 213 SER CB HB3 sing N N 214 SER OG HG sing N N 215 SER OXT HXT sing N N 216 THR N CA sing N N 217 THR N H sing N N 218 THR N H2 sing N N 219 THR CA C sing N N 220 THR CA CB sing N N 221 THR CA HA sing N N 222 THR C O doub N N 223 THR C OXT sing N N 224 THR CB OG1 sing N N 225 THR CB CG2 sing N N 226 THR CB HB sing N N 227 THR OG1 HG1 sing N N 228 THR CG2 HG21 sing N N 229 THR CG2 HG22 sing N N 230 THR CG2 HG23 sing N N 231 THR OXT HXT sing N N 232 TYR N CA sing N N 233 TYR N H sing N N 234 TYR N H2 sing N N 235 TYR CA C sing N N 236 TYR CA CB sing N N 237 TYR CA HA sing N N 238 TYR C O doub N N 239 TYR C OXT sing N N 240 TYR CB CG sing N N 241 TYR CB HB2 sing N N 242 TYR CB HB3 sing N N 243 TYR CG CD1 doub Y N 244 TYR CG CD2 sing Y N 245 TYR CD1 CE1 sing Y N 246 TYR CD1 HD1 sing N N 247 TYR CD2 CE2 doub Y N 248 TYR CD2 HD2 sing N N 249 TYR CE1 CZ doub Y N 250 TYR CE1 HE1 sing N N 251 TYR CE2 CZ sing Y N 252 TYR CE2 HE2 sing N N 253 TYR CZ OH sing N N 254 TYR OH HH sing N N 255 TYR OXT HXT sing N N 256 VAL N CA sing N N 257 VAL N H sing N N 258 VAL N H2 sing N N 259 VAL CA C sing N N 260 VAL CA CB sing N N 261 VAL CA HA sing N N 262 VAL C O doub N N 263 VAL C OXT sing N N 264 VAL CB CG1 sing N N 265 VAL CB CG2 sing N N 266 VAL CB HB sing N N 267 VAL CG1 HG11 sing N N 268 VAL CG1 HG12 sing N N 269 VAL CG1 HG13 sing N N 270 VAL CG2 HG21 sing N N 271 VAL CG2 HG22 sing N N 272 VAL CG2 HG23 sing N N 273 VAL OXT HXT sing N N 274 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2RR0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #