data_2RR2 # _entry.id 2RR2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RR2 pdb_00002rr2 10.2210/pdb2rr2/pdb RCSB RCSB150183 ? ? WWPDB D_1000150183 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-10-13 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-07-29 4 'Structure model' 1 3 2024-10-16 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp 2 3 'Structure model' entity 3 3 'Structure model' pdbx_chem_comp_identifier 4 3 'Structure model' pdbx_entity_nonpoly 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_site 8 3 'Structure model' struct_site_gen 9 4 'Structure model' chem_comp 10 4 'Structure model' chem_comp_atom 11 4 'Structure model' chem_comp_bond 12 4 'Structure model' database_2 13 4 'Structure model' pdbx_entry_details 14 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_chem_comp.name' 2 3 'Structure model' '_chem_comp.type' 3 3 'Structure model' '_entity.pdbx_description' 4 3 'Structure model' '_pdbx_entity_nonpoly.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 3 'Structure model' '_struct_conn.pdbx_role' 8 4 'Structure model' '_chem_comp.pdbx_synonyms' 9 4 'Structure model' '_database_2.pdbx_DOI' 10 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RR2 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-02-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1TOZ PDB 'human NOTCH-1 ligand binding region' unspecified 2JOA PDB 'the PDZ domains of human HtrA1 and HtrA3' unspecified 2RQZ PDB 'sugar modified epidermal growth factor-like repeat 12 of mouse Notch-1 receptor' unspecified 2RR0 PDB 'epidermal growth factor-like repeat 12 of mouse Notch-1 receptor' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hosoguchi, K.' 1 'Shimizu, K.' 2 'Fujitani, N.' 3 'Nishimura, S.' 4 # _citation.id primary _citation.title ;Chemical Synthesis, Folding, and Structural Insights into O-Fucosylated Epidermal Growth Factor-like Repeat 12 of Mouse Notch-1 Receptor ; _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 132 _citation.page_first 14857 _citation.page_last 14865 _citation.year 2010 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20883017 _citation.pdbx_database_id_DOI 10.1021/ja105216u # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hiruma-Shimizu, K.' 1 ? primary 'Hosoguchi, K.' 2 ? primary 'Liu, Y.' 3 ? primary 'Fujitani, N.' 4 ? primary 'Ohta, T.' 5 ? primary 'Hinou, H.' 6 ? primary 'Matsushita, T.' 7 ? primary 'Shimizu, H.' 8 ? primary 'Feizi, T.' 9 ? primary 'Nishimura, S.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Neurogenic locus notch homolog protein 1' 4218.697 1 ? ? 'EXTRACELLULAR DOMAIN EGF-LIKE repeat 12' ? 2 non-polymer man alpha-L-fucopyranose 164.156 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Notch 1, Motch A, mT14, p300' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI _entity_poly.pdbx_seq_one_letter_code_can DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name alpha-L-fucopyranose _pdbx_entity_nonpoly.comp_id FUC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 VAL n 1 3 ASN n 1 4 GLU n 1 5 CYS n 1 6 ILE n 1 7 SER n 1 8 ASN n 1 9 PRO n 1 10 CYS n 1 11 GLN n 1 12 ASN n 1 13 ASP n 1 14 ALA n 1 15 THR n 1 16 CYS n 1 17 LEU n 1 18 ASP n 1 19 GLN n 1 20 ILE n 1 21 GLY n 1 22 GLU n 1 23 PHE n 1 24 GLN n 1 25 CYS n 1 26 ILE n 1 27 CYS n 1 28 MET n 1 29 PRO n 1 30 GLY n 1 31 TYR n 1 32 GLU n 1 33 GLY n 1 34 VAL n 1 35 TYR n 1 36 CYS n 1 37 GLU n 1 38 ILE n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Mus musculus' _pdbx_entity_src_syn.organism_common_name MOUSE _pdbx_entity_src_syn.ncbi_taxonomy_id 10090 _pdbx_entity_src_syn.details 'synthetic peptide' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose 'alpha-L-fucose; 6-deoxy-alpha-L-galactopyranose; L-fucose; fucose' 'C6 H12 O5' 164.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FUC _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 39 _pdbx_nonpoly_scheme.auth_seq_num 39 _pdbx_nonpoly_scheme.pdb_mon_id FUC _pdbx_nonpoly_scheme.auth_mon_id FUC _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RR2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RR2 _struct.title 'Structure of O-fucosylated epidermal growth factor-like repeat 12 of mouse Notch-1 receptor' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RR2 _struct_keywords.pdbx_keywords RECEPTOR _struct_keywords.text ;Notch, Glycopeptide, O-Linked Fucose, Fringe, EGF-Like Domain, Activator, ANK repeat, Cell membrane, Developmental protein, Differentiation, Disulfide bond, Glycoprotein, Metal-binding, Notch signaling pathway, Nucleus, Phosphoprotein, Receptor, Transcription, Transcription regulation, Transmembrane ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NOTC1_MOUSE _struct_ref.pdbx_db_accession Q01705 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEI _struct_ref.pdbx_align_begin 452 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RR2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 38 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q01705 _struct_ref_seq.db_align_beg 452 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 489 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 38 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 5 A CYS 16 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 27 A CYS 36 1_555 ? ? ? ? ? ? ? 2.030 ? ? covale1 covale one ? A THR 15 OG1 ? ? ? 1_555 B FUC . C1 ? ? A THR 15 A FUC 39 1_555 ? ? ? ? ? ? ? 1.383 ? O-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 FUC B . ? THR A 15 ? FUC A 39 ? 1_555 THR A 15 ? 1_555 C1 OG1 THR 2 FUC O-Glycosylation Carbohydrate 2 CYS A 5 ? CYS A 16 ? CYS A 5 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 10 ? CYS A 25 ? CYS A 10 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 27 ? CYS A 36 ? CYS A 27 ? 1_555 CYS A 36 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 15 ? ASP A 18 ? THR A 15 ASP A 18 A 2 PHE A 23 ? ILE A 26 ? PHE A 23 ILE A 26 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 15 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 15 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 26 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 26 # _pdbx_entry_details.entry_id 2RR2 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 3 ? ? 60.57 86.99 2 1 SER A 7 ? ? -141.98 52.56 3 1 ASN A 8 ? ? 61.62 118.32 4 1 GLN A 11 ? ? -91.74 44.06 5 1 ASP A 13 ? ? -90.02 39.25 6 1 LEU A 17 ? ? -172.20 80.38 7 1 ILE A 20 ? ? -68.87 70.58 8 1 PHE A 23 ? ? -176.00 103.17 9 1 CYS A 27 ? ? -60.79 -167.64 10 1 PRO A 29 ? ? -55.65 93.97 11 1 CYS A 36 ? ? 46.91 75.97 12 2 VAL A 2 ? ? -100.33 79.93 13 2 ASN A 3 ? ? -160.47 -46.11 14 2 SER A 7 ? ? -143.39 52.66 15 2 ASN A 8 ? ? 62.29 119.63 16 2 GLN A 11 ? ? -91.82 43.76 17 2 ASP A 13 ? ? -89.85 38.49 18 2 LEU A 17 ? ? -157.29 66.69 19 2 ILE A 20 ? ? -56.30 103.98 20 2 PHE A 23 ? ? -177.54 113.71 21 2 CYS A 27 ? ? -59.26 -168.01 22 2 PRO A 29 ? ? -50.73 95.27 23 2 CYS A 36 ? ? 52.09 98.17 24 2 GLU A 37 ? ? -166.71 -39.51 25 3 GLU A 4 ? ? -100.27 42.55 26 3 ASN A 8 ? ? -52.34 107.15 27 3 GLN A 11 ? ? -96.02 42.57 28 3 ASP A 13 ? ? -89.94 41.33 29 3 ILE A 20 ? ? 52.70 85.28 30 3 CYS A 36 ? ? 57.85 104.59 31 3 GLU A 37 ? ? -168.28 -33.88 32 4 ASN A 8 ? ? -54.38 108.15 33 4 GLN A 11 ? ? -96.75 43.14 34 4 ASP A 13 ? ? -91.02 38.25 35 4 PRO A 29 ? ? -53.22 88.82 36 4 CYS A 36 ? ? 56.33 102.56 37 4 GLU A 37 ? ? -177.67 -34.43 38 5 GLN A 11 ? ? -92.29 43.85 39 5 ASP A 13 ? ? -89.83 44.62 40 5 CYS A 36 ? ? 47.48 97.27 41 5 GLU A 37 ? ? -173.92 -35.88 42 6 SER A 7 ? ? -144.20 55.42 43 6 ASN A 8 ? ? 61.38 114.76 44 6 GLN A 11 ? ? -92.36 44.84 45 6 ASP A 13 ? ? -89.84 37.88 46 6 LEU A 17 ? ? -110.26 61.99 47 6 ILE A 20 ? ? -58.82 105.91 48 6 CYS A 36 ? ? 50.43 97.07 49 6 GLU A 37 ? ? -171.74 -33.71 50 7 VAL A 2 ? ? -113.51 79.22 51 7 SER A 7 ? ? -140.34 49.64 52 7 ASN A 8 ? ? 60.82 118.46 53 7 GLN A 11 ? ? -91.52 45.04 54 7 ASN A 12 ? ? -150.66 -159.47 55 7 ASP A 13 ? ? -89.98 35.65 56 7 ILE A 20 ? ? -58.87 94.00 57 7 CYS A 27 ? ? -63.15 -167.67 58 7 CYS A 36 ? ? 47.76 95.94 59 7 GLU A 37 ? ? -166.56 -36.46 60 8 ASN A 3 ? ? -147.94 21.82 61 8 ASN A 8 ? ? -54.39 108.43 62 8 ASN A 12 ? ? -150.24 -91.74 63 8 ASP A 13 ? ? -150.29 30.28 64 8 ALA A 14 ? ? -68.59 -176.17 65 8 LEU A 17 ? ? -159.86 41.21 66 8 TYR A 35 ? ? -117.00 -70.34 67 8 CYS A 36 ? ? 178.56 68.17 68 8 GLU A 37 ? ? -140.36 -35.85 69 9 ASN A 3 ? ? 60.49 85.43 70 9 ASN A 8 ? ? 48.37 91.84 71 9 GLN A 11 ? ? -93.95 42.20 72 9 ALA A 14 ? ? -67.54 -177.01 73 9 GLN A 19 ? ? -108.01 74.27 74 9 CYS A 27 ? ? -74.43 -169.81 75 9 PRO A 29 ? ? -50.61 90.77 76 9 CYS A 36 ? ? 60.44 108.92 77 9 GLU A 37 ? ? -179.83 -32.00 78 10 ASN A 3 ? ? -94.15 -60.13 79 10 ASN A 8 ? ? -49.15 105.74 80 10 GLN A 11 ? ? -97.74 42.48 81 10 ASP A 13 ? ? -91.23 38.40 82 10 PRO A 29 ? ? -55.80 92.85 83 10 CYS A 36 ? ? 60.03 105.44 84 10 GLU A 37 ? ? -176.39 -35.18 85 11 GLU A 4 ? ? -146.60 -74.59 86 11 SER A 7 ? ? -142.16 52.50 87 11 ASN A 8 ? ? 58.49 107.01 88 11 GLN A 11 ? ? -91.52 45.22 89 11 ASP A 13 ? ? -89.92 41.13 90 11 LEU A 17 ? ? -169.22 49.29 91 11 CYS A 36 ? ? 49.78 96.72 92 11 GLU A 37 ? ? -177.13 -36.12 93 12 ASN A 8 ? ? 57.20 97.22 94 12 GLN A 11 ? ? -94.76 43.98 95 12 ILE A 20 ? ? 52.84 94.57 96 12 CYS A 27 ? ? -59.79 -166.07 97 12 PRO A 29 ? ? -51.46 92.61 98 12 CYS A 36 ? ? 62.41 115.19 99 12 GLU A 37 ? ? -165.68 -54.59 100 13 ASN A 8 ? ? -50.63 109.71 101 13 GLN A 11 ? ? -95.09 43.79 102 13 ASP A 13 ? ? -90.50 34.45 103 13 ILE A 20 ? ? -58.46 91.68 104 13 PHE A 23 ? ? -174.04 113.77 105 13 CYS A 27 ? ? -59.31 -169.40 106 13 PRO A 29 ? ? -52.32 92.16 107 13 CYS A 36 ? ? 55.27 101.54 108 13 GLU A 37 ? ? -172.66 -35.56 109 14 ASN A 3 ? ? -129.76 -66.96 110 14 GLN A 11 ? ? -112.78 54.34 111 14 ASN A 12 ? ? -150.24 -92.82 112 14 ASP A 13 ? ? -150.30 24.24 113 14 LEU A 17 ? ? -141.69 52.64 114 14 ASP A 18 ? ? -150.96 89.41 115 14 GLN A 19 ? ? -149.27 42.04 116 14 ILE A 20 ? ? -169.48 59.92 117 14 CYS A 27 ? ? -68.98 -179.81 118 14 PRO A 29 ? ? -52.30 89.52 119 14 CYS A 36 ? ? 46.92 96.47 120 14 GLU A 37 ? ? -143.62 -65.66 121 15 ASN A 3 ? ? -161.33 -68.53 122 15 GLN A 11 ? ? -93.22 45.18 123 15 ASP A 13 ? ? -89.95 42.73 124 15 LEU A 17 ? ? -175.53 64.97 125 15 CYS A 36 ? ? 49.20 96.70 126 15 GLU A 37 ? ? -178.46 -37.26 127 16 GLU A 4 ? ? -134.96 -44.67 128 16 ASN A 8 ? ? 52.99 96.33 129 16 GLN A 11 ? ? -92.63 44.61 130 16 ILE A 20 ? ? 55.62 103.95 131 16 CYS A 36 ? ? 56.79 101.76 132 16 GLU A 37 ? ? -175.65 -34.97 133 17 SER A 7 ? ? -140.30 51.20 134 17 ASN A 8 ? ? 51.86 98.88 135 17 GLN A 11 ? ? -97.88 42.00 136 17 ASN A 12 ? ? -150.47 -157.64 137 17 ILE A 20 ? ? -59.98 102.60 138 17 PRO A 29 ? ? -48.55 96.30 139 17 TYR A 35 ? ? -98.59 30.66 140 18 CYS A 5 ? ? -150.02 89.26 141 18 SER A 7 ? ? -146.32 52.62 142 18 ASN A 8 ? ? 60.92 117.50 143 18 GLN A 11 ? ? -96.87 42.19 144 18 ASP A 13 ? ? -89.75 43.37 145 18 LEU A 17 ? ? -148.78 59.85 146 18 CYS A 27 ? ? -124.95 -161.91 147 18 TYR A 35 ? ? -142.56 57.54 148 18 CYS A 36 ? ? 48.88 92.31 149 18 GLU A 37 ? ? -169.71 -39.64 150 19 ASN A 3 ? ? -135.04 -55.63 151 19 GLU A 4 ? ? -157.97 35.73 152 19 SER A 7 ? ? -145.60 52.82 153 19 ASN A 8 ? ? 61.41 119.78 154 19 GLN A 11 ? ? -92.80 44.35 155 19 ASP A 13 ? ? -90.10 37.74 156 19 LEU A 17 ? ? -154.05 69.89 157 19 ILE A 20 ? ? -57.53 88.18 158 19 CYS A 27 ? ? -65.53 -170.96 159 19 PRO A 29 ? ? -58.24 84.48 160 19 CYS A 36 ? ? 53.11 96.25 161 19 GLU A 37 ? ? -166.72 -39.67 162 20 GLN A 11 ? ? -91.84 44.87 163 20 ASP A 13 ? ? -89.94 41.63 164 20 LEU A 17 ? ? -145.38 51.74 165 20 ILE A 20 ? ? -147.75 30.96 166 20 PRO A 29 ? ? -53.48 87.17 167 20 CYS A 36 ? ? 50.17 96.91 168 20 GLU A 37 ? ? -140.71 -50.24 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id THR _pdbx_struct_mod_residue.label_seq_id 15 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id THR _pdbx_struct_mod_residue.auth_seq_id 15 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details 'GLYCOSYLATION SITE' # _pdbx_database_remark.id 700 _pdbx_database_remark.text ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RR2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RR2 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.67mM NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1; 0.67mM ALPHA-L-FUCOSE; 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.67mM NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1; 0.67mM ALPHA-L-FUCOSE; 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1-1' 0.67 ? mM ? 1 ALPHA-L-FUCOSE-2 0.67 ? mM ? 1 'NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1-3' 0.67 ? mM ? 2 ALPHA-L-FUCOSE-4 0.67 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D DQF-COSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D 1H-1H TOCSY' 1 4 2 '2D 1H-1H TOCSY' # _pdbx_nmr_details.entry_id 2RR2 _pdbx_nmr_details.text 'The structure was determined using a combination NOE and D2O exchange experiment.' # _pdbx_nmr_refine.entry_id 2RR2 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details 'Sugar ring was fixed in chair conformation.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors ? _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 1.1 _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 FUC C1 C N R 61 FUC C2 C N S 62 FUC C3 C N R 63 FUC C4 C N S 64 FUC C5 C N S 65 FUC C6 C N N 66 FUC O1 O N N 67 FUC O2 O N N 68 FUC O3 O N N 69 FUC O4 O N N 70 FUC O5 O N N 71 FUC H1 H N N 72 FUC H2 H N N 73 FUC H3 H N N 74 FUC H4 H N N 75 FUC H5 H N N 76 FUC H61 H N N 77 FUC H62 H N N 78 FUC H63 H N N 79 FUC HO1 H N N 80 FUC HO2 H N N 81 FUC HO3 H N N 82 FUC HO4 H N N 83 GLN N N N N 84 GLN CA C N S 85 GLN C C N N 86 GLN O O N N 87 GLN CB C N N 88 GLN CG C N N 89 GLN CD C N N 90 GLN OE1 O N N 91 GLN NE2 N N N 92 GLN OXT O N N 93 GLN H H N N 94 GLN H2 H N N 95 GLN HA H N N 96 GLN HB2 H N N 97 GLN HB3 H N N 98 GLN HG2 H N N 99 GLN HG3 H N N 100 GLN HE21 H N N 101 GLN HE22 H N N 102 GLN HXT H N N 103 GLU N N N N 104 GLU CA C N S 105 GLU C C N N 106 GLU O O N N 107 GLU CB C N N 108 GLU CG C N N 109 GLU CD C N N 110 GLU OE1 O N N 111 GLU OE2 O N N 112 GLU OXT O N N 113 GLU H H N N 114 GLU H2 H N N 115 GLU HA H N N 116 GLU HB2 H N N 117 GLU HB3 H N N 118 GLU HG2 H N N 119 GLU HG3 H N N 120 GLU HE2 H N N 121 GLU HXT H N N 122 GLY N N N N 123 GLY CA C N N 124 GLY C C N N 125 GLY O O N N 126 GLY OXT O N N 127 GLY H H N N 128 GLY H2 H N N 129 GLY HA2 H N N 130 GLY HA3 H N N 131 GLY HXT H N N 132 ILE N N N N 133 ILE CA C N S 134 ILE C C N N 135 ILE O O N N 136 ILE CB C N S 137 ILE CG1 C N N 138 ILE CG2 C N N 139 ILE CD1 C N N 140 ILE OXT O N N 141 ILE H H N N 142 ILE H2 H N N 143 ILE HA H N N 144 ILE HB H N N 145 ILE HG12 H N N 146 ILE HG13 H N N 147 ILE HG21 H N N 148 ILE HG22 H N N 149 ILE HG23 H N N 150 ILE HD11 H N N 151 ILE HD12 H N N 152 ILE HD13 H N N 153 ILE HXT H N N 154 LEU N N N N 155 LEU CA C N S 156 LEU C C N N 157 LEU O O N N 158 LEU CB C N N 159 LEU CG C N N 160 LEU CD1 C N N 161 LEU CD2 C N N 162 LEU OXT O N N 163 LEU H H N N 164 LEU H2 H N N 165 LEU HA H N N 166 LEU HB2 H N N 167 LEU HB3 H N N 168 LEU HG H N N 169 LEU HD11 H N N 170 LEU HD12 H N N 171 LEU HD13 H N N 172 LEU HD21 H N N 173 LEU HD22 H N N 174 LEU HD23 H N N 175 LEU HXT H N N 176 MET N N N N 177 MET CA C N S 178 MET C C N N 179 MET O O N N 180 MET CB C N N 181 MET CG C N N 182 MET SD S N N 183 MET CE C N N 184 MET OXT O N N 185 MET H H N N 186 MET H2 H N N 187 MET HA H N N 188 MET HB2 H N N 189 MET HB3 H N N 190 MET HG2 H N N 191 MET HG3 H N N 192 MET HE1 H N N 193 MET HE2 H N N 194 MET HE3 H N N 195 MET HXT H N N 196 PHE N N N N 197 PHE CA C N S 198 PHE C C N N 199 PHE O O N N 200 PHE CB C N N 201 PHE CG C Y N 202 PHE CD1 C Y N 203 PHE CD2 C Y N 204 PHE CE1 C Y N 205 PHE CE2 C Y N 206 PHE CZ C Y N 207 PHE OXT O N N 208 PHE H H N N 209 PHE H2 H N N 210 PHE HA H N N 211 PHE HB2 H N N 212 PHE HB3 H N N 213 PHE HD1 H N N 214 PHE HD2 H N N 215 PHE HE1 H N N 216 PHE HE2 H N N 217 PHE HZ H N N 218 PHE HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TYR N N N N 268 TYR CA C N S 269 TYR C C N N 270 TYR O O N N 271 TYR CB C N N 272 TYR CG C Y N 273 TYR CD1 C Y N 274 TYR CD2 C Y N 275 TYR CE1 C Y N 276 TYR CE2 C Y N 277 TYR CZ C Y N 278 TYR OH O N N 279 TYR OXT O N N 280 TYR H H N N 281 TYR H2 H N N 282 TYR HA H N N 283 TYR HB2 H N N 284 TYR HB3 H N N 285 TYR HD1 H N N 286 TYR HD2 H N N 287 TYR HE1 H N N 288 TYR HE2 H N N 289 TYR HH H N N 290 TYR HXT H N N 291 VAL N N N N 292 VAL CA C N S 293 VAL C C N N 294 VAL O O N N 295 VAL CB C N N 296 VAL CG1 C N N 297 VAL CG2 C N N 298 VAL OXT O N N 299 VAL H H N N 300 VAL H2 H N N 301 VAL HA H N N 302 VAL HB H N N 303 VAL HG11 H N N 304 VAL HG12 H N N 305 VAL HG13 H N N 306 VAL HG21 H N N 307 VAL HG22 H N N 308 VAL HG23 H N N 309 VAL HXT H N N 310 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 FUC C1 C2 sing N N 57 FUC C1 O1 sing N N 58 FUC C1 O5 sing N N 59 FUC C1 H1 sing N N 60 FUC C2 C3 sing N N 61 FUC C2 O2 sing N N 62 FUC C2 H2 sing N N 63 FUC C3 C4 sing N N 64 FUC C3 O3 sing N N 65 FUC C3 H3 sing N N 66 FUC C4 C5 sing N N 67 FUC C4 O4 sing N N 68 FUC C4 H4 sing N N 69 FUC C5 C6 sing N N 70 FUC C5 O5 sing N N 71 FUC C5 H5 sing N N 72 FUC C6 H61 sing N N 73 FUC C6 H62 sing N N 74 FUC C6 H63 sing N N 75 FUC O1 HO1 sing N N 76 FUC O2 HO2 sing N N 77 FUC O3 HO3 sing N N 78 FUC O4 HO4 sing N N 79 GLN N CA sing N N 80 GLN N H sing N N 81 GLN N H2 sing N N 82 GLN CA C sing N N 83 GLN CA CB sing N N 84 GLN CA HA sing N N 85 GLN C O doub N N 86 GLN C OXT sing N N 87 GLN CB CG sing N N 88 GLN CB HB2 sing N N 89 GLN CB HB3 sing N N 90 GLN CG CD sing N N 91 GLN CG HG2 sing N N 92 GLN CG HG3 sing N N 93 GLN CD OE1 doub N N 94 GLN CD NE2 sing N N 95 GLN NE2 HE21 sing N N 96 GLN NE2 HE22 sing N N 97 GLN OXT HXT sing N N 98 GLU N CA sing N N 99 GLU N H sing N N 100 GLU N H2 sing N N 101 GLU CA C sing N N 102 GLU CA CB sing N N 103 GLU CA HA sing N N 104 GLU C O doub N N 105 GLU C OXT sing N N 106 GLU CB CG sing N N 107 GLU CB HB2 sing N N 108 GLU CB HB3 sing N N 109 GLU CG CD sing N N 110 GLU CG HG2 sing N N 111 GLU CG HG3 sing N N 112 GLU CD OE1 doub N N 113 GLU CD OE2 sing N N 114 GLU OE2 HE2 sing N N 115 GLU OXT HXT sing N N 116 GLY N CA sing N N 117 GLY N H sing N N 118 GLY N H2 sing N N 119 GLY CA C sing N N 120 GLY CA HA2 sing N N 121 GLY CA HA3 sing N N 122 GLY C O doub N N 123 GLY C OXT sing N N 124 GLY OXT HXT sing N N 125 ILE N CA sing N N 126 ILE N H sing N N 127 ILE N H2 sing N N 128 ILE CA C sing N N 129 ILE CA CB sing N N 130 ILE CA HA sing N N 131 ILE C O doub N N 132 ILE C OXT sing N N 133 ILE CB CG1 sing N N 134 ILE CB CG2 sing N N 135 ILE CB HB sing N N 136 ILE CG1 CD1 sing N N 137 ILE CG1 HG12 sing N N 138 ILE CG1 HG13 sing N N 139 ILE CG2 HG21 sing N N 140 ILE CG2 HG22 sing N N 141 ILE CG2 HG23 sing N N 142 ILE CD1 HD11 sing N N 143 ILE CD1 HD12 sing N N 144 ILE CD1 HD13 sing N N 145 ILE OXT HXT sing N N 146 LEU N CA sing N N 147 LEU N H sing N N 148 LEU N H2 sing N N 149 LEU CA C sing N N 150 LEU CA CB sing N N 151 LEU CA HA sing N N 152 LEU C O doub N N 153 LEU C OXT sing N N 154 LEU CB CG sing N N 155 LEU CB HB2 sing N N 156 LEU CB HB3 sing N N 157 LEU CG CD1 sing N N 158 LEU CG CD2 sing N N 159 LEU CG HG sing N N 160 LEU CD1 HD11 sing N N 161 LEU CD1 HD12 sing N N 162 LEU CD1 HD13 sing N N 163 LEU CD2 HD21 sing N N 164 LEU CD2 HD22 sing N N 165 LEU CD2 HD23 sing N N 166 LEU OXT HXT sing N N 167 MET N CA sing N N 168 MET N H sing N N 169 MET N H2 sing N N 170 MET CA C sing N N 171 MET CA CB sing N N 172 MET CA HA sing N N 173 MET C O doub N N 174 MET C OXT sing N N 175 MET CB CG sing N N 176 MET CB HB2 sing N N 177 MET CB HB3 sing N N 178 MET CG SD sing N N 179 MET CG HG2 sing N N 180 MET CG HG3 sing N N 181 MET SD CE sing N N 182 MET CE HE1 sing N N 183 MET CE HE2 sing N N 184 MET CE HE3 sing N N 185 MET OXT HXT sing N N 186 PHE N CA sing N N 187 PHE N H sing N N 188 PHE N H2 sing N N 189 PHE CA C sing N N 190 PHE CA CB sing N N 191 PHE CA HA sing N N 192 PHE C O doub N N 193 PHE C OXT sing N N 194 PHE CB CG sing N N 195 PHE CB HB2 sing N N 196 PHE CB HB3 sing N N 197 PHE CG CD1 doub Y N 198 PHE CG CD2 sing Y N 199 PHE CD1 CE1 sing Y N 200 PHE CD1 HD1 sing N N 201 PHE CD2 CE2 doub Y N 202 PHE CD2 HD2 sing N N 203 PHE CE1 CZ doub Y N 204 PHE CE1 HE1 sing N N 205 PHE CE2 CZ sing Y N 206 PHE CE2 HE2 sing N N 207 PHE CZ HZ sing N N 208 PHE OXT HXT sing N N 209 PRO N CA sing N N 210 PRO N CD sing N N 211 PRO N H sing N N 212 PRO CA C sing N N 213 PRO CA CB sing N N 214 PRO CA HA sing N N 215 PRO C O doub N N 216 PRO C OXT sing N N 217 PRO CB CG sing N N 218 PRO CB HB2 sing N N 219 PRO CB HB3 sing N N 220 PRO CG CD sing N N 221 PRO CG HG2 sing N N 222 PRO CG HG3 sing N N 223 PRO CD HD2 sing N N 224 PRO CD HD3 sing N N 225 PRO OXT HXT sing N N 226 SER N CA sing N N 227 SER N H sing N N 228 SER N H2 sing N N 229 SER CA C sing N N 230 SER CA CB sing N N 231 SER CA HA sing N N 232 SER C O doub N N 233 SER C OXT sing N N 234 SER CB OG sing N N 235 SER CB HB2 sing N N 236 SER CB HB3 sing N N 237 SER OG HG sing N N 238 SER OXT HXT sing N N 239 THR N CA sing N N 240 THR N H sing N N 241 THR N H2 sing N N 242 THR CA C sing N N 243 THR CA CB sing N N 244 THR CA HA sing N N 245 THR C O doub N N 246 THR C OXT sing N N 247 THR CB OG1 sing N N 248 THR CB CG2 sing N N 249 THR CB HB sing N N 250 THR OG1 HG1 sing N N 251 THR CG2 HG21 sing N N 252 THR CG2 HG22 sing N N 253 THR CG2 HG23 sing N N 254 THR OXT HXT sing N N 255 TYR N CA sing N N 256 TYR N H sing N N 257 TYR N H2 sing N N 258 TYR CA C sing N N 259 TYR CA CB sing N N 260 TYR CA HA sing N N 261 TYR C O doub N N 262 TYR C OXT sing N N 263 TYR CB CG sing N N 264 TYR CB HB2 sing N N 265 TYR CB HB3 sing N N 266 TYR CG CD1 doub Y N 267 TYR CG CD2 sing Y N 268 TYR CD1 CE1 sing Y N 269 TYR CD1 HD1 sing N N 270 TYR CD2 CE2 doub Y N 271 TYR CD2 HD2 sing N N 272 TYR CE1 CZ doub Y N 273 TYR CE1 HE1 sing N N 274 TYR CE2 CZ sing Y N 275 TYR CE2 HE2 sing N N 276 TYR CZ OH sing N N 277 TYR OH HH sing N N 278 TYR OXT HXT sing N N 279 VAL N CA sing N N 280 VAL N H sing N N 281 VAL N H2 sing N N 282 VAL CA C sing N N 283 VAL CA CB sing N N 284 VAL CA HA sing N N 285 VAL C O doub N N 286 VAL C OXT sing N N 287 VAL CB CG1 sing N N 288 VAL CB CG2 sing N N 289 VAL CB HB sing N N 290 VAL CG1 HG11 sing N N 291 VAL CG1 HG12 sing N N 292 VAL CG1 HG13 sing N N 293 VAL CG2 HG21 sing N N 294 VAL CG2 HG22 sing N N 295 VAL CG2 HG23 sing N N 296 VAL OXT HXT sing N N 297 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2RR2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #