data_2RSC # _entry.id 2RSC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RSC pdb_00002rsc 10.2210/pdb2rsc/pdb RCSB RCSB150225 ? ? BMRB 11468 ? ? WWPDB D_1000150225 ? ? # _pdbx_database_related.db_id 11468 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RSC _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-12-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sato, M.' 1 'Tochio, N.' 2 'Aizawa, T.' 3 # _citation.id primary _citation.title 'Solution Structure of the Bombyx Mori LYSOZYME' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sato, M.' 1 ? primary 'Tochio, N.' 2 ? primary 'Watanabe, S.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Aizawa, T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Lysozyme _entity.formula_weight 13834.649 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.17 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 1,4-beta-N-acetylmuramidase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GKTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLL TDDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC ; _entity_poly.pdbx_seq_one_letter_code_can ;GKTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLL TDDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 THR n 1 4 PHE n 1 5 THR n 1 6 ARG n 1 7 CYS n 1 8 GLY n 1 9 LEU n 1 10 VAL n 1 11 HIS n 1 12 GLU n 1 13 LEU n 1 14 ARG n 1 15 LYS n 1 16 HIS n 1 17 GLY n 1 18 PHE n 1 19 GLU n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 MET n 1 24 ARG n 1 25 ASN n 1 26 TRP n 1 27 VAL n 1 28 CYS n 1 29 LEU n 1 30 VAL n 1 31 GLU n 1 32 HIS n 1 33 GLU n 1 34 SER n 1 35 SER n 1 36 ARG n 1 37 ASP n 1 38 THR n 1 39 SER n 1 40 LYS n 1 41 THR n 1 42 ASN n 1 43 THR n 1 44 ASN n 1 45 ARG n 1 46 ASN n 1 47 GLY n 1 48 SER n 1 49 LYS n 1 50 ASP n 1 51 TYR n 1 52 GLY n 1 53 LEU n 1 54 PHE n 1 55 GLN n 1 56 ILE n 1 57 ASN n 1 58 ASP n 1 59 ARG n 1 60 TYR n 1 61 TRP n 1 62 CYS n 1 63 SER n 1 64 LYS n 1 65 GLY n 1 66 ALA n 1 67 SER n 1 68 PRO n 1 69 GLY n 1 70 LYS n 1 71 ASP n 1 72 CYS n 1 73 ASN n 1 74 VAL n 1 75 LYS n 1 76 CYS n 1 77 SER n 1 78 ASP n 1 79 LEU n 1 80 LEU n 1 81 THR n 1 82 ASP n 1 83 ASP n 1 84 ILE n 1 85 THR n 1 86 LYS n 1 87 ALA n 1 88 ALA n 1 89 LYS n 1 90 CYS n 1 91 ALA n 1 92 LYS n 1 93 LYS n 1 94 ILE n 1 95 TYR n 1 96 LYS n 1 97 ARG n 1 98 HIS n 1 99 ARG n 1 100 PHE n 1 101 ASP n 1 102 ALA n 1 103 TRP n 1 104 TYR n 1 105 GLY n 1 106 TRP n 1 107 LYS n 1 108 ASN n 1 109 HIS n 1 110 CYS n 1 111 GLN n 1 112 GLY n 1 113 SER n 1 114 LEU n 1 115 PRO n 1 116 ASP n 1 117 ILE n 1 118 SER n 1 119 SER n 1 120 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'silk moth, silkworm' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bombyx mori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7091 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector P101129-01 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYS_BOMMO _struct_ref.pdbx_db_accession P48816 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KTFTRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASPGKDCNVKCSDLLT DDITKAAKCAKKIYKRHRFDAWYGWKNHCQGSLPDISSC ; _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RSC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 120 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P48816 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 137 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 120 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2RSC _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P48816 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY' 1 2 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pH 3.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '20 mM sodium acetate-1, 100 mM sodium chloride-2, 0.02 % sodium azide-3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RSC _pdbx_nmr_refine.method 'torsion angle dynamics, DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RSC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RSC _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' 'structure solution' Amber 1 ? 'Bruker Biospin' collection TopSpin 2 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 4 ? 'Johnson, One Moon Scientific' 'data analysis' NMRView 5 ? 'Kobayashi, N.' 'data analysis' KUJIRA 6 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 7 ? 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 8 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RSC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RSC _struct.title 'Solution Structure of the bombyx mori lysozyme' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RSC _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'LYSOZYME, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? HIS A 16 ? THR A 5 HIS A 16 1 ? 12 HELX_P HELX_P2 2 LEU A 22 ? SER A 34 ? LEU A 22 SER A 34 1 ? 13 HELX_P HELX_P3 3 SER A 77 ? THR A 81 ? SER A 77 THR A 81 5 ? 5 HELX_P HELX_P4 4 ILE A 84 ? LYS A 96 ? ILE A 84 LYS A 96 1 ? 13 HELX_P HELX_P5 5 TRP A 103 ? HIS A 109 ? TRP A 103 HIS A 109 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 41 ? THR A 43 ? THR A 41 THR A 43 A 2 LYS A 49 ? TYR A 51 ? LYS A 49 TYR A 51 A 3 ILE A 56 ? ASN A 57 ? ILE A 56 ASN A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 42 ? N ASN A 42 O ASP A 50 ? O ASP A 50 A 2 3 N TYR A 51 ? N TYR A 51 O ILE A 56 ? O ILE A 56 # _atom_sites.entry_id 2RSC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 TRP 26 26 26 TRP TRP A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 TRP 61 61 61 TRP TRP A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 CYS 72 72 72 CYS CYS A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 TRP 106 106 106 TRP TRP A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 CYS 110 110 110 CYS CYS A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 CYS 120 120 120 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-12-26 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium acetate-1' 20 ? mM ? 1 'sodium chloride-2' 100 ? mM ? 1 'sodium azide-3' 0.02 ? % ? 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.36 120.30 3.06 0.50 N 2 3 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.38 120.30 3.08 0.50 N 3 4 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.37 120.30 3.07 0.50 N 4 6 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.39 120.30 3.09 0.50 N 5 7 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.35 120.30 3.05 0.50 N 6 9 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.34 120.30 3.04 0.50 N 7 11 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.31 120.30 3.01 0.50 N 8 17 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.34 120.30 3.04 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 61 ? ? -147.33 -51.11 2 1 PHE A 100 ? ? -142.78 -15.84 3 1 HIS A 109 ? ? -136.91 -32.14 4 2 TYR A 60 ? ? -130.77 -59.10 5 2 PHE A 100 ? ? -142.21 -10.32 6 2 HIS A 109 ? ? -138.94 -44.20 7 2 SER A 113 ? ? -173.19 145.73 8 3 TYR A 60 ? ? -135.36 -47.78 9 3 PHE A 100 ? ? -142.56 -17.14 10 4 TYR A 60 ? ? -131.15 -52.95 11 4 LYS A 70 ? ? -124.60 -164.36 12 4 PHE A 100 ? ? -140.01 -9.85 13 4 HIS A 109 ? ? -143.21 -14.18 14 5 TRP A 61 ? ? -144.56 -36.64 15 5 PHE A 100 ? ? -142.03 -11.21 16 6 TYR A 60 ? ? -136.90 -48.59 17 6 TRP A 106 ? ? -93.45 -63.00 18 7 TYR A 60 ? ? -130.19 -42.73 19 7 TRP A 61 ? ? -144.58 -36.76 20 7 PHE A 100 ? ? -141.60 -1.86 21 7 HIS A 109 ? ? -133.23 -45.86 22 8 TYR A 60 ? ? -132.64 -58.25 23 8 PHE A 100 ? ? -143.44 -6.53 24 8 TRP A 106 ? ? -79.75 -70.65 25 8 HIS A 109 ? ? -138.72 -44.55 26 9 TRP A 61 ? ? -137.50 -42.80 27 9 PHE A 100 ? ? -143.60 -18.17 28 10 TRP A 61 ? ? -138.78 -55.83 29 10 LYS A 70 ? ? -127.92 -165.53 30 10 PHE A 100 ? ? -141.93 -3.54 31 10 HIS A 109 ? ? -137.21 -45.96 32 11 TYR A 60 ? ? -130.65 -61.85 33 11 LYS A 70 ? ? -119.01 -168.87 34 11 PHE A 100 ? ? -144.46 -4.42 35 12 TRP A 61 ? ? -138.47 -56.89 36 12 LYS A 70 ? ? -121.90 -168.86 37 12 PHE A 100 ? ? -140.70 -4.83 38 13 TYR A 60 ? ? -131.00 -59.41 39 13 LYS A 70 ? ? -119.34 -168.91 40 14 ARG A 36 ? ? 71.08 32.01 41 14 TYR A 60 ? ? -131.60 -35.17 42 14 TRP A 61 ? ? -139.67 -40.17 43 14 PHE A 100 ? ? -142.93 -16.48 44 15 GLU A 33 ? ? -94.58 -60.26 45 15 TRP A 61 ? ? -134.35 -37.30 46 15 PHE A 100 ? ? -145.69 -3.57 47 15 HIS A 109 ? ? -131.72 -45.54 48 16 TYR A 60 ? ? -132.55 -39.31 49 16 TRP A 61 ? ? -144.29 -40.59 50 16 PHE A 100 ? ? -143.84 -13.40 51 16 SER A 113 ? ? -172.41 143.16 52 17 TRP A 61 ? ? -140.69 -34.04 53 17 HIS A 98 ? ? -152.31 86.95 54 17 PHE A 100 ? ? -140.09 -4.31 55 17 HIS A 109 ? ? -137.75 -39.92 56 18 TYR A 60 ? ? -132.90 -34.17 57 18 TRP A 61 ? ? -136.67 -41.95 58 18 PHE A 100 ? ? -142.18 -15.67 59 18 HIS A 109 ? ? -154.96 -18.17 60 19 TRP A 61 ? ? -142.98 -28.56 61 19 PHE A 100 ? ? -142.61 -3.47 62 19 TRP A 106 ? ? -92.73 -65.84 63 19 HIS A 109 ? ? -150.99 -21.96 64 20 TYR A 60 ? ? -130.61 -59.63 65 20 ARG A 99 ? ? 43.82 -56.18 66 20 PHE A 100 ? ? -142.73 -9.22 67 20 HIS A 109 ? ? -133.03 -47.17 68 20 SER A 113 ? ? -174.12 148.40 #