data_2RSX # _entry.id 2RSX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RSX pdb_00002rsx 10.2210/pdb2rsx/pdb RCSB RCSB150244 ? ? BMRB 11507 ? ? WWPDB D_1000150244 ? ? # _pdbx_database_related.db_id 11507 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RSX _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-08-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Arai, R.' 1 'Li, H.' 2 'Tochio, N.' 3 'Fukui, S.' 4 'Kobayashi, N.' 5 'Kitaura, C.' 6 'Watanabe, S.' 7 'Kigawa, T.' 8 'Sekiguchi, J.' 9 # _citation.id primary _citation.title ;Solution Structure of IseA, an Inhibitor Protein of DL-Endopeptidases from Bacillus subtilis, Reveals a Novel Fold with a Characteristic Inhibitory Loop ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 44736 _citation.page_last 44748 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23091053 _citation.pdbx_database_id_DOI 10.1074/jbc.M112.414763 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arai, R.' 1 ? primary 'Fukui, S.' 2 ? primary 'Kobayashi, N.' 3 ? primary 'Sekiguchi, J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein yoeB' _entity.formula_weight 17728.395 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IseA, Inhibitor protein of cell Separation Enzyme' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEK GFKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI ; _entity_poly.pdbx_seq_one_letter_code_can ;GKNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEK GFKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LYS n 1 3 ASN n 1 4 THR n 1 5 SER n 1 6 GLY n 1 7 ASP n 1 8 LEU n 1 9 SER n 1 10 GLN n 1 11 LYS n 1 12 GLN n 1 13 ALA n 1 14 LEU n 1 15 GLN n 1 16 LEU n 1 17 ALA n 1 18 LEU n 1 19 SER n 1 20 ALA n 1 21 ARG n 1 22 GLU n 1 23 HIS n 1 24 PHE n 1 25 TRP n 1 26 ASN n 1 27 THR n 1 28 MET n 1 29 SER n 1 30 GLY n 1 31 HIS n 1 32 ASN n 1 33 PRO n 1 34 LYS n 1 35 VAL n 1 36 LYS n 1 37 LYS n 1 38 ALA n 1 39 VAL n 1 40 CYS n 1 41 PRO n 1 42 SER n 1 43 GLY n 1 44 THR n 1 45 PHE n 1 46 GLU n 1 47 TYR n 1 48 GLN n 1 49 ASN n 1 50 LEU n 1 51 GLN n 1 52 TYR n 1 53 VAL n 1 54 TYR n 1 55 MET n 1 56 CYS n 1 57 SER n 1 58 ASP n 1 59 LEU n 1 60 GLY n 1 61 THR n 1 62 LYS n 1 63 ALA n 1 64 LYS n 1 65 ALA n 1 66 VAL n 1 67 ASN n 1 68 TYR n 1 69 LEU n 1 70 THR n 1 71 PRO n 1 72 ILE n 1 73 PHE n 1 74 THR n 1 75 LYS n 1 76 THR n 1 77 ALA n 1 78 ILE n 1 79 GLU n 1 80 LYS n 1 81 GLY n 1 82 PHE n 1 83 LYS n 1 84 ASP n 1 85 TYR n 1 86 HIS n 1 87 PHE n 1 88 THR n 1 89 VAL n 1 90 SER n 1 91 LYS n 1 92 GLY n 1 93 LYS n 1 94 LEU n 1 95 ALA n 1 96 VAL n 1 97 PRO n 1 98 ILE n 1 99 GLY n 1 100 ASP n 1 101 GLY n 1 102 ASP n 1 103 ASN n 1 104 LEU n 1 105 LEU n 1 106 ASN n 1 107 TRP n 1 108 LYS n 1 109 LYS n 1 110 SER n 1 111 THR n 1 112 ALA n 1 113 LYS n 1 114 LEU n 1 115 ILE n 1 116 SER n 1 117 LYS n 1 118 LYS n 1 119 GLY n 1 120 SER n 1 121 THR n 1 122 ILE n 1 123 THR n 1 124 TYR n 1 125 GLU n 1 126 PHE n 1 127 THR n 1 128 VAL n 1 129 PRO n 1 130 THR n 1 131 LEU n 1 132 ASP n 1 133 GLY n 1 134 SER n 1 135 PRO n 1 136 SER n 1 137 ALA n 1 138 LYS n 1 139 ARG n 1 140 LYS n 1 141 VAL n 1 142 THR n 1 143 PHE n 1 144 VAL n 1 145 LYS n 1 146 GLU n 1 147 ASN n 1 148 LYS n 1 149 LYS n 1 150 TRP n 1 151 LYS n 1 152 VAL n 1 153 ASN n 1 154 GLN n 1 155 PHE n 1 156 ASP n 1 157 ALA n 1 158 VAL n 1 159 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene yoeB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'E. coli CELL-FREE PROTEIN SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pCR2.1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YOEB_BACSU _struct_ref.pdbx_db_accession O34841 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KNTSGDLSQKQALQLALSAREHFWNTMSGHNPKVKKAVCPSGTFEYQNLQYVYMCSDLGTKAKAVNYLTPIFTKTAIEKG FKDYHFTVSKGKLAVPIGDGDNLLNWKKSTAKLISKKGSTITYEFTVPTLDGSPSAKRKVTFVKENKKWKVNQFDAVI ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RSX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O34841 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 181 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 159 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2RSX _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O34841 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CA)CO' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D C(CCO)NH' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D HCCH-TOCSY' 1 13 1 '3D HCCH-COSY' 1 14 1 '3D 1H-15N NOESY' 1 15 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.3 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.12 mM [U-13C; U-15N] IseA-1, 20 mM [U-2H] TRIS-2, 300 mM sodium chloride-3, 0.02 % sodium azide-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RSX _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RSX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RSX _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 1 2.0.17 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2 2.0.17 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement Amber 3 9 ? refinement CYANA 4 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RSX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RSX _struct.title 'Solution structure of IseA, an inhibitor protein of DL-endopeptidases from Bacillus subtilis' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RSX _struct_keywords.pdbx_keywords 'HYDROLASE INHIBITOR' _struct_keywords.text 'inhibitor protein, hacksaw-like fold, autolysin inhibitor, DL-endopeptidase inhibitor, HYDROLASE INHIBITOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? SER A 29 ? SER A 9 SER A 29 1 ? 21 HELX_P HELX_P2 2 THR A 61 ? THR A 70 ? THR A 61 THR A 70 1 ? 10 HELX_P HELX_P3 3 THR A 74 ? ASP A 84 ? THR A 74 ASP A 84 1 ? 11 HELX_P HELX_P4 4 ASN A 106 ? SER A 110 ? ASN A 106 SER A 110 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 40 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 56 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 40 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 56 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.040 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 44 ? TYR A 47 ? THR A 44 TYR A 47 A 2 LEU A 50 ? TYR A 54 ? LEU A 50 TYR A 54 A 3 LYS A 93 ? PRO A 97 ? LYS A 93 PRO A 97 A 4 THR A 88 ? SER A 90 ? THR A 88 SER A 90 B 1 THR A 111 ? LYS A 118 ? THR A 111 LYS A 118 B 2 THR A 121 ? VAL A 128 ? THR A 121 VAL A 128 B 3 ALA A 137 ? LYS A 145 ? ALA A 137 LYS A 145 B 4 TRP A 150 ? VAL A 152 ? TRP A 150 VAL A 152 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 45 ? N PHE A 45 O TYR A 52 ? O TYR A 52 A 2 3 N VAL A 53 ? N VAL A 53 O VAL A 96 ? O VAL A 96 A 3 4 O ALA A 95 ? O ALA A 95 N THR A 88 ? N THR A 88 B 1 2 N LYS A 113 ? N LYS A 113 O GLU A 125 ? O GLU A 125 B 2 3 N VAL A 128 ? N VAL A 128 O ALA A 137 ? O ALA A 137 B 3 4 N VAL A 144 ? N VAL A 144 O LYS A 151 ? O LYS A 151 # _atom_sites.entry_id 2RSX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 TRP 25 25 25 TRP TRP A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ILE 115 115 115 ILE ILE A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASP 132 132 132 ASP ASP A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 THR 142 142 142 THR THR A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 PHE 155 155 155 PHE PHE A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ILE 159 159 159 ILE ILE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-10-31 2 'Structure model' 1 1 2013-01-23 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id IseA-1 1.12 ? mM '[U-13C; U-15N]' 1 TRIS-2 20 ? mM '[U-2H]' 1 'sodium chloride-3' 300 ? mM ? 1 'sodium azide-4' 0.02 ? % ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2RSX _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3659 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 852 _pdbx_nmr_constraints.NOE_long_range_total_count 1320 _pdbx_nmr_constraints.NOE_medium_range_total_count 651 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 836 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.51 120.30 3.21 0.50 N 2 2 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.42 120.30 3.12 0.50 N 3 3 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.49 120.30 3.19 0.50 N 4 3 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 116.64 120.30 -3.66 0.50 N 5 4 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.46 120.30 3.16 0.50 N 6 5 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.62 120.30 3.32 0.50 N 7 6 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.42 120.30 3.12 0.50 N 8 6 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 116.51 120.30 -3.79 0.50 N 9 7 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.63 120.30 3.33 0.50 N 10 8 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.47 120.30 3.17 0.50 N 11 9 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.32 120.30 3.02 0.50 N 12 11 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.45 120.30 3.15 0.50 N 13 12 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.41 120.30 3.11 0.50 N 14 13 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.55 120.30 3.25 0.50 N 15 13 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 116.48 120.30 -3.82 0.50 N 16 14 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.67 120.30 3.37 0.50 N 17 15 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.51 120.30 3.21 0.50 N 18 16 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.41 120.30 3.11 0.50 N 19 16 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 116.97 120.30 -3.33 0.50 N 20 17 NE A ARG 139 ? ? CZ A ARG 139 ? ? NH1 A ARG 139 ? ? 123.52 120.30 3.22 0.50 N 21 19 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.53 120.30 3.23 0.50 N 22 20 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH1 A ARG 21 ? ? 123.46 120.30 3.16 0.50 N 23 20 NE A ARG 21 ? ? CZ A ARG 21 ? ? NH2 A ARG 21 ? ? 116.84 120.30 -3.46 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -152.59 33.52 2 1 ASP A 7 ? ? -159.41 -45.07 3 1 ASN A 147 ? ? -159.90 -69.30 4 2 SER A 5 ? ? -143.50 -63.08 5 2 ASP A 7 ? ? -165.07 -51.81 6 3 ASN A 147 ? ? -159.72 -69.45 7 4 ASN A 3 ? ? 71.58 136.03 8 4 ASN A 147 ? ? -150.42 69.78 9 5 LYS A 2 ? ? 74.01 121.56 10 5 SER A 5 ? ? -161.71 117.50 11 5 ASP A 102 ? ? 72.26 161.26 12 5 ASN A 147 ? ? -163.02 93.98 13 6 LYS A 91 ? ? 59.30 18.45 14 6 ASP A 102 ? ? 70.85 171.12 15 6 ASN A 147 ? ? -161.53 -68.36 16 7 ASN A 147 ? ? -158.96 89.60 17 8 ASN A 147 ? ? -161.51 92.29 18 10 ASP A 7 ? ? -156.24 -43.71 19 10 ASP A 102 ? ? -153.00 2.33 20 10 ASN A 103 ? ? 60.63 165.90 21 10 ASN A 147 ? ? -162.49 93.52 22 11 LEU A 104 ? ? -72.46 20.80 23 11 ASN A 147 ? ? -160.62 90.18 24 12 ASP A 7 ? ? -158.80 -42.49 25 12 GLU A 146 ? ? -108.22 -111.82 26 13 ASP A 102 ? ? -166.11 118.39 27 14 THR A 4 ? ? -161.73 43.10 28 14 ASP A 7 ? ? -160.25 -45.36 29 14 ASP A 102 ? ? 73.19 159.81 30 15 ASN A 3 ? ? -148.71 30.22 31 15 ASP A 7 ? ? 59.15 -118.25 32 15 ASN A 147 ? ? -161.19 -68.35 33 16 ASP A 7 ? ? -161.92 -42.58 34 16 HIS A 31 ? ? -171.00 132.87 35 16 LEU A 104 ? ? -67.44 1.13 36 19 ASP A 7 ? ? 73.72 -71.59 37 19 ASP A 100 ? ? -158.80 -41.60 38 19 ASN A 103 ? ? -178.10 -23.02 39 19 LEU A 104 ? ? 58.58 10.43 40 19 ASN A 147 ? ? -160.41 -64.67 41 20 ASN A 147 ? ? 52.86 72.97 #