data_2RT6 # _entry.id 2RT6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RT6 pdb_00002rt6 10.2210/pdb2rt6/pdb RCSB RCSB150253 ? ? BMRB 11525 ? ? WWPDB D_1000150253 ? ? # _pdbx_database_related.db_id 11525 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RT6 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-04-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aramaki, T.' 1 'Abe, Y.' 2 'Katayama, T.' 3 'Ueda, T.' 4 # _citation.id primary _citation.title 'Solution structure of the N-terminal domain of a replication restart primosome factor, PriC, in Escherichia coli.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 22 _citation.page_first 1279 _citation.page_last 1286 _citation.year 2013 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 1469-896X _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23868391 _citation.pdbx_database_id_DOI 10.1002/pro.2314 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aramaki, T.' 1 ? primary 'Abe, Y.' 2 ? primary 'Katayama, T.' 3 ? primary 'Ueda, T.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description ;Primosomal replication protein N'' ; _entity.formula_weight 11007.533 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP RESIDUES 1-98' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATTLQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLA AQLEAIAREASAWSLREW ; _entity_poly.pdbx_seq_one_letter_code_can ;MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATTLQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLA AQLEAIAREASAWSLREW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 THR n 1 4 ALA n 1 5 LEU n 1 6 LEU n 1 7 LEU n 1 8 GLU n 1 9 LYS n 1 10 LEU n 1 11 GLU n 1 12 GLY n 1 13 GLN n 1 14 LEU n 1 15 ALA n 1 16 THR n 1 17 LEU n 1 18 ARG n 1 19 GLN n 1 20 ARG n 1 21 CYS n 1 22 ALA n 1 23 PRO n 1 24 VAL n 1 25 SER n 1 26 GLN n 1 27 PHE n 1 28 ALA n 1 29 THR n 1 30 LEU n 1 31 SER n 1 32 ALA n 1 33 ARG n 1 34 PHE n 1 35 ASP n 1 36 ARG n 1 37 HIS n 1 38 LEU n 1 39 PHE n 1 40 GLN n 1 41 THR n 1 42 ARG n 1 43 ALA n 1 44 THR n 1 45 THR n 1 46 LEU n 1 47 GLN n 1 48 ALA n 1 49 CYS n 1 50 LEU n 1 51 ASP n 1 52 GLU n 1 53 ALA n 1 54 GLY n 1 55 ASP n 1 56 ASN n 1 57 LEU n 1 58 ALA n 1 59 ALA n 1 60 LEU n 1 61 ARG n 1 62 HIS n 1 63 ALA n 1 64 VAL n 1 65 GLU n 1 66 GLN n 1 67 GLN n 1 68 GLN n 1 69 LEU n 1 70 PRO n 1 71 GLN n 1 72 VAL n 1 73 ALA n 1 74 TRP n 1 75 LEU n 1 76 ALA n 1 77 GLU n 1 78 HIS n 1 79 LEU n 1 80 ALA n 1 81 ALA n 1 82 GLN n 1 83 LEU n 1 84 GLU n 1 85 ALA n 1 86 ILE n 1 87 ALA n 1 88 ARG n 1 89 GLU n 1 90 ALA n 1 91 SER n 1 92 ALA n 1 93 TRP n 1 94 SER n 1 95 LEU n 1 96 ARG n 1 97 GLU n 1 98 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'b0467, JW0456, priC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET22b(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIC_ECOLI _struct_ref.pdbx_db_accession P23862 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKTALLLEKLEGQLATLRQRCAPVSQFATLSARFDRHLFQTRATTLQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLA AQLEAIAREASAWSLREW ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RT6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P23862 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-15N HSQC' 1 3 1 '2D 1H-13C HSQC aliphatic' 1 4 1 '2D 1H-13C HSQC aromatic' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D C(CO)NH' 1 7 1 '3D HNCO' 1 8 1 '3D HNCA' 1 9 1 '3D HNCACB' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D HN(CO)CA' 1 12 1 '3D H(CCO)NH' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D 1H-15N NOESY' 1 15 1 '3D 1H-15N TOCSY' 1 16 1 '3D 1H-13C NOESY aliphatic' 1 17 1 '3D 1H-13C NOESY aromatic' 1 18 1 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-99% 13C; U-99% 15N] PriC N-terminal domain-1, 150 mM sodium chloride-2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.2 mM [U-98% 15N] PriC N-terminal domain-3, 150 mM sodium chloride-4, 100% D2O' 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2RT6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 2.7 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RT6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.01 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.06 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.2 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RT6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 2.1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis' NMRPipe 2 ? 'Olivia Developer Team' 'chemical shift assignment' Olivia 3 1.16.6 'Olivia Developer Team' 'data analysis' Olivia 4 1.16.6 ? refinement CNS 5 1.21 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 6 1.21 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RT6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RT6 _struct.title 'Backbone 1H, 13C, and 15N Chemical Shift Assignments for PriC N-terminal domain' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RT6 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'Primosome, Replication restart, PriC, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 2 ? CYS A 21 ? LYS A 2 CYS A 21 1 ? 20 HELX_P HELX_P2 2 THR A 45 ? VAL A 64 ? THR A 45 VAL A 64 1 ? 20 HELX_P HELX_P3 3 GLU A 65 ? GLN A 67 ? GLU A 65 GLN A 67 5 ? 3 HELX_P HELX_P4 4 GLN A 68 ? SER A 94 ? GLN A 68 SER A 94 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2RT6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 TRP 74 74 74 TRP TRP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 TRP 98 98 98 TRP TRP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-08-07 2 'Structure model' 1 1 2022-08-24 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_database_2.pdbx_DOI' 5 2 'Structure model' '_database_2.pdbx_database_accession' 6 2 'Structure model' '_pdbx_nmr_software.name' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0022 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0002 _pdbx_nmr_ensemble_rms.entry_id 2RT6 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'PriC N-terminal domain-1' 0.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 150 ? mM ? 1 'PriC N-terminal domain-3' 0.2 ? mM '[U-98% 15N]' 2 'sodium chloride-4' 150 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2RT6 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 0 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 908 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 297 _pdbx_nmr_constraints.NOE_long_range_total_count 124 _pdbx_nmr_constraints.NOE_medium_range_total_count 172 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 307 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 87 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 87 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? 69.40 -65.86 2 1 SER A 31 ? ? -59.90 176.01 3 1 ALA A 43 ? ? -59.84 87.10 4 1 GLN A 68 ? ? -97.24 37.39 5 1 SER A 94 ? ? 67.22 150.69 6 1 LEU A 95 ? ? -65.27 80.65 7 1 ARG A 96 ? ? -161.79 30.58 8 1 GLU A 97 ? ? 61.04 165.25 9 2 LYS A 2 ? ? -94.31 43.78 10 2 PRO A 23 ? ? -84.80 44.66 11 2 LEU A 95 ? ? -154.63 24.41 12 2 ARG A 96 ? ? -167.19 31.26 13 3 LYS A 2 ? ? 69.40 -66.10 14 3 ALA A 43 ? ? -57.00 89.23 15 3 ARG A 96 ? ? -178.18 37.89 16 3 GLU A 97 ? ? 58.12 92.33 17 4 ALA A 43 ? ? -56.18 90.34 18 4 GLN A 68 ? ? -97.27 37.37 19 4 SER A 94 ? ? 60.62 -164.55 20 4 ARG A 96 ? ? 178.43 61.54 21 4 GLU A 97 ? ? -54.91 170.22 22 5 LEU A 95 ? ? -111.07 58.57 23 5 ARG A 96 ? ? -163.88 31.06 24 6 ALA A 43 ? ? -63.60 86.48 25 6 LEU A 95 ? ? 58.20 107.44 26 6 ARG A 96 ? ? -160.08 29.27 27 6 GLU A 97 ? ? 58.11 72.81 28 7 GLN A 68 ? ? -98.65 37.47 29 7 LEU A 95 ? ? -97.59 30.31 30 7 ARG A 96 ? ? -164.30 30.58 31 7 GLU A 97 ? ? 58.52 107.40 32 8 PRO A 23 ? ? -83.87 47.34 33 8 ALA A 43 ? ? -105.21 75.90 34 8 ARG A 96 ? ? -177.44 46.77 35 8 GLU A 97 ? ? 42.37 93.99 36 9 PRO A 23 ? ? -86.70 39.11 37 9 GLN A 68 ? ? -98.30 37.38 38 9 ARG A 96 ? ? -165.62 29.83 39 9 GLU A 97 ? ? 63.21 -77.85 40 10 LYS A 2 ? ? -153.96 30.50 41 10 ALA A 43 ? ? -63.33 93.93 42 10 SER A 94 ? ? -49.45 167.99 43 10 ARG A 96 ? ? -157.11 28.15 44 11 LYS A 2 ? ? 60.74 97.41 45 11 GLN A 68 ? ? -98.26 37.42 46 11 LEU A 95 ? ? -96.53 52.50 47 11 ARG A 96 ? ? -153.97 25.59 48 12 ALA A 43 ? ? -56.81 88.95 49 12 ARG A 96 ? ? -162.37 29.10 50 13 PRO A 23 ? ? -86.32 41.76 51 13 ARG A 96 ? ? -157.74 27.72 52 13 GLU A 97 ? ? 59.78 110.62 53 14 GLN A 68 ? ? -97.60 37.35 54 14 ARG A 96 ? ? -176.85 38.38 55 14 GLU A 97 ? ? 63.21 102.51 56 15 ALA A 43 ? ? -66.71 83.41 57 15 GLN A 68 ? ? -97.16 37.38 58 15 ARG A 96 ? ? -177.49 37.91 59 15 GLU A 97 ? ? 60.19 164.26 60 16 ALA A 43 ? ? -55.45 89.71 61 16 ARG A 96 ? ? -166.53 32.54 62 16 GLU A 97 ? ? 62.16 116.88 63 17 LYS A 2 ? ? 60.13 97.71 64 17 PRO A 23 ? ? -83.75 48.43 65 17 ARG A 96 ? ? -178.82 33.80 66 17 GLU A 97 ? ? 59.45 -82.73 67 18 LYS A 2 ? ? 61.37 168.28 68 18 GLN A 68 ? ? -95.35 37.49 69 18 ARG A 96 ? ? -160.03 29.41 70 19 LYS A 2 ? ? -176.43 37.69 71 19 PRO A 23 ? ? -84.32 44.89 72 19 SER A 94 ? ? 60.63 105.48 73 19 ARG A 96 ? ? -159.32 52.84 74 20 LYS A 2 ? ? 62.52 118.20 75 20 PRO A 23 ? ? -83.18 47.73 76 20 ALA A 43 ? ? -60.13 89.36 77 20 GLN A 68 ? ? -97.54 37.40 78 20 SER A 94 ? ? -55.90 93.91 79 20 LEU A 95 ? ? -153.37 29.86 80 20 ARG A 96 ? ? -177.82 38.57 81 20 GLU A 97 ? ? 62.68 86.48 #