data_2RTU # _entry.id 2RTU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RTU pdb_00002rtu 10.2210/pdb2rtu/pdb RCSB RCSB150259 ? ? BMRB 11532 ? ? WWPDB D_1000150259 ? ? # _pdbx_database_related.db_id 11532 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RTU _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-09-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jing, W.' 1 'Tochio, N.' 2 'Tate, S.' 3 # _citation.id primary _citation.title 'Redox-sensitive structural change in the A-domain of HMGB1 and its implication for the binding to cisplatin modified DNA.' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 441 _citation.page_first 701 _citation.page_last 706 _citation.year 2013 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 1090-2104 _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24427810 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, J.' 1 ? primary 'Tochio, N.' 2 ? primary 'Takeuchi, A.' 3 ? primary 'Uewaki, J.' 4 ? primary 'Kobayashi, N.' 5 ? primary 'Tate, S.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'High mobility group protein B1' _entity.formula_weight 10118.655 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG box 1, UNP residues 1-84' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'High mobility group protein 1, HMG-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKT YIPPKGE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKT YIPPKGE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 LYS n 1 7 GLY n 1 8 ASP n 1 9 PRO n 1 10 LYS n 1 11 LYS n 1 12 PRO n 1 13 ARG n 1 14 GLY n 1 15 LYS n 1 16 MET n 1 17 SER n 1 18 SER n 1 19 TYR n 1 20 ALA n 1 21 PHE n 1 22 PHE n 1 23 VAL n 1 24 GLN n 1 25 THR n 1 26 CYS n 1 27 ARG n 1 28 GLU n 1 29 GLU n 1 30 HIS n 1 31 LYS n 1 32 LYS n 1 33 LYS n 1 34 HIS n 1 35 PRO n 1 36 ASP n 1 37 ALA n 1 38 SER n 1 39 VAL n 1 40 ASN n 1 41 PHE n 1 42 SER n 1 43 GLU n 1 44 PHE n 1 45 SER n 1 46 LYS n 1 47 LYS n 1 48 CYS n 1 49 SER n 1 50 GLU n 1 51 ARG n 1 52 TRP n 1 53 LYS n 1 54 THR n 1 55 MET n 1 56 SER n 1 57 ALA n 1 58 LYS n 1 59 GLU n 1 60 LYS n 1 61 GLY n 1 62 LYS n 1 63 PHE n 1 64 GLU n 1 65 ASP n 1 66 MET n 1 67 ALA n 1 68 LYS n 1 69 ALA n 1 70 ASP n 1 71 LYS n 1 72 ALA n 1 73 ARG n 1 74 TYR n 1 75 GLU n 1 76 ARG n 1 77 GLU n 1 78 MET n 1 79 LYS n 1 80 THR n 1 81 TYR n 1 82 ILE n 1 83 PRO n 1 84 PRO n 1 85 LYS n 1 86 GLY n 1 87 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HMGB1, HMG1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HMGB1_HUMAN _struct_ref.pdbx_db_accession P09429 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIP PKGE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RTU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 87 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09429 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RTU GLY A 1 ? UNP P09429 ? ? 'expression tag' 1 1 1 2RTU SER A 2 ? UNP P09429 ? ? 'expression tag' 2 2 1 2RTU HIS A 3 ? UNP P09429 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '2D 1H-15N IPAP-HSQC' 1 4 2 '2D 1H-15N IPAP-HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5-0.6 mM [U-13C; U-15N] protein-1, 50 mM potassium phosphate-2, 10 % [U-2H] D2O-3, 150 mM potassium chloride-4, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' ;0.5-0.6 mM [U-13C; U-15N] protein-5, 5 % C12E5/n-hexanol-6, 10 % U-2H D2O-7, 150 mM potassium chloride-8, 50 mM potassium phosphate-9, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RTU _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RTU _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RTU _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection TopSpin 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 ? 'Kobayashi N.' 'data analysis' MAGRO 3 ? 'Johnson, One Moon Scientific' 'data analysis' NMRView 4 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 5 ? Goddard 'data analysis' Sparky 6 ? 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 7 ? 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 8 ? 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 9 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RTU _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RTU _struct.title 'Solution structure of oxidized human HMGB1 A box' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RTU _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'disulfide bond, High Mobility Group Box 1, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 17 ? HIS A 34 ? SER A 17 HIS A 34 1 ? 18 HELX_P HELX_P2 2 ASN A 40 ? LYS A 53 ? ASN A 40 LYS A 53 1 ? 14 HELX_P HELX_P3 3 SER A 56 ? ASP A 70 ? SER A 56 ASP A 70 1 ? 15 HELX_P HELX_P4 4 ASP A 70 ? LYS A 79 ? ASP A 70 LYS A 79 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 26 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 48 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 48 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.032 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2RTU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 GLU 87 87 87 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-05 2 'Structure model' 1 1 2019-06-05 3 'Structure model' 1 2 2019-10-16 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_nmr_software 4 3 'Structure model' citation 5 3 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation_author.name' 9 2 'Structure model' '_pdbx_nmr_software.name' 10 3 'Structure model' '_citation.journal_abbrev' 11 3 'Structure model' '_pdbx_nmr_spectrometer.model' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' 14 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 15 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 ? 0.5-0.6 mM '[U-13C; U-15N]' 1 'potassium phosphate-2' 50 ? mM ? 1 D2O-3 10 ? % '[U-2H]' 1 'potassium chloride-4' 150 ? mM ? 1 entity-5 ? 0.5-0.6 mM '[U-13C; U-15N]' 2 C12E5/n-hexanol-6 5 ? % ? 2 D2O-7 10 ? % '[U-2H]' 2 'potassium chloride-8' 150 ? mM ? 2 'potassium phosphate-9' 50 ? mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 OE1 A GLU 29 ? ? HH12 A ARG 51 ? ? 1.57 2 5 HZ1 A LYS 71 ? ? OE1 A GLU 75 ? ? 1.59 3 5 OH A TYR 19 ? ? HG A SER 49 ? ? 1.59 4 5 HG A SER 18 ? ? OE1 A GLU 64 ? ? 1.60 5 10 HG A SER 18 ? ? OE1 A GLU 64 ? ? 1.60 6 12 HG A SER 18 ? ? OE1 A GLU 64 ? ? 1.57 7 15 O A ALA 37 ? ? H A VAL 39 ? ? 1.52 8 18 OE2 A GLU 28 ? ? HZ2 A LYS 32 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 25 ? ? -77.93 -71.49 2 1 CYS A 26 ? ? -36.72 -36.62 3 1 ASN A 40 ? ? -32.32 127.91 4 2 GLU A 28 ? ? -51.99 -77.71 5 2 ASN A 40 ? ? -58.75 -174.35 6 3 LYS A 15 ? ? -93.53 -106.60 7 3 ALA A 37 ? ? -25.71 -45.91 8 3 LYS A 85 ? ? -91.72 57.06 9 4 SER A 38 ? ? 93.87 140.78 10 5 THR A 25 ? ? -90.05 -63.51 11 5 ALA A 37 ? ? -29.81 -51.25 12 5 VAL A 39 ? ? -125.93 -162.34 13 5 SER A 56 ? ? -67.38 -177.27 14 6 LYS A 15 ? ? -98.52 -158.27 15 6 VAL A 39 ? ? -112.02 -136.13 16 7 ASN A 40 ? ? -52.34 179.36 17 8 MET A 4 ? ? 72.85 -13.62 18 8 LYS A 6 ? ? 68.65 -68.21 19 8 LYS A 15 ? ? -72.49 -168.74 20 8 ALA A 37 ? ? -14.73 -60.97 21 8 SER A 38 ? ? 39.89 41.26 22 9 ARG A 13 ? ? -152.82 -58.62 23 9 GLU A 28 ? ? -56.51 -70.53 24 9 ASN A 40 ? ? -37.99 161.61 25 10 MET A 4 ? ? 69.44 -66.37 26 10 ALA A 37 ? ? -66.68 -75.88 27 10 SER A 38 ? ? 73.73 150.32 28 10 ASN A 40 ? ? -32.97 131.45 29 11 ARG A 13 ? ? -88.81 30.73 30 11 LYS A 15 ? ? -101.73 -157.73 31 11 GLU A 59 ? ? -70.56 -71.00 32 12 LYS A 10 ? ? 73.98 -3.30 33 12 LYS A 15 ? ? -177.24 -165.66 34 12 SER A 17 ? ? -75.21 -166.41 35 12 CYS A 26 ? ? -35.56 -36.13 36 12 SER A 38 ? ? 76.21 150.34 37 12 ASN A 40 ? ? -37.09 133.69 38 13 SER A 38 ? ? 37.35 65.56 39 14 ALA A 37 ? ? 59.42 -94.38 40 14 VAL A 39 ? ? -122.08 -165.48 41 15 LYS A 15 ? ? -85.38 -149.39 42 15 SER A 38 ? ? 54.79 -55.86 43 15 ASN A 40 ? ? -39.34 141.45 44 15 PRO A 84 ? ? -58.16 105.70 45 16 CYS A 26 ? ? -34.15 -38.64 46 16 VAL A 39 ? ? -53.28 104.57 47 16 ASN A 40 ? ? -31.88 135.89 48 16 LYS A 85 ? ? -88.10 34.90 49 17 CYS A 26 ? ? -46.68 -17.18 50 17 SER A 38 ? ? 90.91 146.31 51 17 VAL A 39 ? ? -97.69 -159.75 52 17 SER A 42 ? ? -95.47 -64.24 53 18 LYS A 6 ? ? -146.47 -59.54 54 18 ARG A 13 ? ? -132.64 -36.46 55 18 GLU A 28 ? ? -50.80 -73.14 56 18 SER A 38 ? ? 71.64 139.21 57 18 ASN A 40 ? ? -73.88 -168.33 58 19 LYS A 15 ? ? -110.34 -94.77 59 19 SER A 38 ? ? -66.98 34.32 60 19 VAL A 39 ? ? -54.02 -153.78 61 19 LYS A 85 ? ? 42.75 71.81 62 20 PRO A 9 ? ? -81.41 48.79 63 20 LYS A 15 ? ? -79.19 -107.56 64 20 VAL A 39 ? ? -52.70 101.95 65 20 ALA A 72 ? ? -57.52 -73.38 #