data_2RU1 # _entry.id 2RU1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RU1 pdb_00002ru1 10.2210/pdb2ru1/pdb RCSB RCSB150266 ? ? BMRB 11540 ? 10.13018/BMR11540 WWPDB D_1000150266 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-04-23 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 9 3 'Structure model' pdbx_entry_details 10 3 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RU1 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2013-11-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 11540 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Umetsu, Y.' 1 'Mori, M.' 2 'Ohki, S.' 3 # _citation.id primary _citation.title 'Central cell-derived peptides regulate early embryo patterning in flowering plants' _citation.journal_abbrev Science _citation.journal_volume 344 _citation.page_first 168 _citation.page_last 172 _citation.year 2014 _citation.journal_id_ASTM SCIEAS _citation.country US _citation.journal_id_ISSN 0036-8075 _citation.journal_id_CSD 0038 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24723605 _citation.pdbx_database_id_DOI 10.1126/science.1243005 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Costa, L.M.' 1 ? primary 'Marshall, E.' 2 ? primary 'Tesfaye, M.' 3 ? primary 'Silverstein, K.A.' 4 ? primary 'Mori, M.' 5 ? primary 'Umetsu, Y.' 6 ? primary 'Otterbach, S.L.' 7 ? primary 'Papareddy, R.' 8 ? primary 'Dickinson, H.G.' 9 ? primary 'Boutiller, K.' 10 ? primary 'Vandenbosch, K.A.' 11 ? primary 'Ohki, S.' 12 ? primary 'Gutierrez-marcos, J.F.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 7976.434 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Uncharacterized protein At1g10717.1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPEKMEVKEIGRSSKIILPACMHETCSGGFSLKNDCWCCLRLKTKQARCWKEKEFPNAKELCFANCPPLE _entity_poly.pdbx_seq_one_letter_code_can GPEKMEVKEIGRSSKIILPACMHETCSGGFSLKNDCWCCLRLKTKQARCWKEKEFPNAKELCFANCPPLE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLU n 1 4 LYS n 1 5 MET n 1 6 GLU n 1 7 VAL n 1 8 LYS n 1 9 GLU n 1 10 ILE n 1 11 GLY n 1 12 ARG n 1 13 SER n 1 14 SER n 1 15 LYS n 1 16 ILE n 1 17 ILE n 1 18 LEU n 1 19 PRO n 1 20 ALA n 1 21 CYS n 1 22 MET n 1 23 HIS n 1 24 GLU n 1 25 THR n 1 26 CYS n 1 27 SER n 1 28 GLY n 1 29 GLY n 1 30 PHE n 1 31 SER n 1 32 LEU n 1 33 LYS n 1 34 ASN n 1 35 ASP n 1 36 CYS n 1 37 TRP n 1 38 CYS n 1 39 CYS n 1 40 LEU n 1 41 ARG n 1 42 LEU n 1 43 LYS n 1 44 THR n 1 45 LYS n 1 46 GLN n 1 47 ALA n 1 48 ARG n 1 49 CYS n 1 50 TRP n 1 51 LYS n 1 52 GLU n 1 53 LYS n 1 54 GLU n 1 55 PHE n 1 56 PRO n 1 57 ASN n 1 58 ALA n 1 59 LYS n 1 60 GLU n 1 61 LEU n 1 62 CYS n 1 63 PHE n 1 64 ALA n 1 65 ASN n 1 66 CYS n 1 67 PRO n 1 68 PRO n 1 69 LEU n 1 70 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress,thale-cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AT1G10717, At1g10717' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'TOMATO MOSAIC VIRUS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 12253 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant BY-2 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'ESTRADIOL INDUCIBLE TOMATO-MOSAIC-VIRUS-BASED VECTOR' _entity_src_gen.pdbx_host_org_vector PBICER8-C0.3-HUIFN-G-SRZ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 GLU 70 70 70 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RU1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RU1 _struct.title 'Solution structure of esf3' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RU1 _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'Plant peptide hormone, HORMONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A8MQA5_ARATH _struct_ref.pdbx_db_accession A8MQA5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EKMEVKEIGRSSKIILPACMHETCSGGFSLKNDCWCCLRLKTKQARCWKEKEFPNAKELCFANCPPLE _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RU1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A8MQA5 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 90 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RU1 GLY A 1 ? UNP A8MQA5 ? ? 'expression tag' 1 1 1 2RU1 PRO A 2 ? UNP A8MQA5 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PHE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 65 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PHE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id ASN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 65 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 26 A CYS 66 1_555 ? ? ? ? ? ? ? 1.863 ? ? disulf2 disulf ? ? A CYS 39 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 39 A CYS 49 1_555 ? ? ? ? ? ? ? 1.840 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 26 ? CYS A 66 ? CYS A 26 ? 1_555 CYS A 66 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 39 ? CYS A 49 ? CYS A 39 ? 1_555 CYS A 49 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 16 ? ILE A 17 ? ILE A 16 ILE A 17 A 2 THR A 25 ? CYS A 26 ? THR A 25 CYS A 26 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 16 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 16 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id CYS _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 26 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 26 # _pdbx_entry_details.entry_id 2RU1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.19 2 1 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.39 3 2 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.48 4 2 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.00 5 3 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.44 6 3 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.66 7 4 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.53 8 4 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.94 9 5 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.12 10 5 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.11 11 6 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.33 12 6 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.16 13 7 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.23 14 7 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.36 15 8 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.04 16 8 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.41 17 9 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.37 18 9 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.74 19 10 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.39 20 10 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.95 21 11 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.46 22 11 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.04 23 12 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.38 24 12 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.05 25 13 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.51 26 13 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.60 27 14 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.36 28 14 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.44 29 15 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.38 30 15 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.68 31 16 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.41 32 16 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.67 33 17 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.32 34 17 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.36 35 18 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.43 36 18 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.10 37 19 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.69 38 19 SG A CYS 21 ? ? SG A CYS 38 ? ? 2.13 39 20 SG A CYS 36 ? ? SG A CYS 62 ? ? 1.48 40 20 SG A CYS 21 ? ? SG A CYS 38 ? ? 1.64 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.78 -169.16 2 1 LYS A 4 ? ? 59.09 88.33 3 1 VAL A 7 ? ? -57.89 174.29 4 1 LYS A 8 ? ? -141.77 -49.68 5 1 GLU A 9 ? ? 60.42 -169.62 6 1 ALA A 20 ? ? -179.74 -76.52 7 1 CYS A 21 ? ? -133.56 -39.38 8 1 MET A 22 ? ? -121.73 -168.00 9 1 SER A 27 ? ? -163.94 115.77 10 1 PHE A 30 ? ? -160.53 -40.69 11 1 LEU A 32 ? ? 51.65 83.54 12 1 CYS A 36 ? ? -47.84 163.72 13 1 TRP A 37 ? ? -113.40 -168.05 14 1 CYS A 39 ? ? -71.91 -168.01 15 1 LEU A 40 ? ? -50.16 -70.74 16 1 LYS A 45 ? ? 176.44 -31.28 17 1 ALA A 47 ? ? -179.67 -72.81 18 2 PRO A 2 ? ? -69.82 -176.73 19 2 VAL A 7 ? ? -175.88 134.18 20 2 GLU A 9 ? ? -106.19 -169.60 21 2 ILE A 10 ? ? -115.77 54.97 22 2 SER A 14 ? ? -98.60 31.04 23 2 ALA A 20 ? ? -179.26 -76.68 24 2 CYS A 21 ? ? -142.41 -42.20 25 2 MET A 22 ? ? -107.73 -169.32 26 2 PHE A 30 ? ? -178.07 -61.75 27 2 LEU A 32 ? ? 56.52 91.98 28 2 TRP A 37 ? ? -112.90 -169.02 29 2 CYS A 39 ? ? -77.75 -168.72 30 2 LYS A 45 ? ? -176.54 -31.10 31 2 ALA A 47 ? ? -179.76 -73.33 32 2 PRO A 68 ? ? -69.75 -176.85 33 3 PRO A 2 ? ? -69.77 -173.70 34 3 ARG A 12 ? ? -103.25 49.16 35 3 ALA A 20 ? ? -178.23 -77.87 36 3 PHE A 30 ? ? -155.58 -41.66 37 3 LEU A 32 ? ? 51.83 88.76 38 3 CYS A 36 ? ? -54.57 177.03 39 3 CYS A 38 ? ? -51.12 103.11 40 3 LEU A 40 ? ? 53.87 -175.36 41 3 LYS A 43 ? ? -141.51 -44.46 42 3 THR A 44 ? ? -108.96 43.46 43 3 LYS A 45 ? ? 74.40 -1.38 44 3 GLN A 46 ? ? -170.47 149.60 45 3 ALA A 47 ? ? -179.41 -76.82 46 3 ASN A 65 ? ? -50.93 103.97 47 3 PRO A 68 ? ? -69.76 -177.28 48 4 MET A 5 ? ? -177.06 106.86 49 4 ARG A 12 ? ? -141.22 48.94 50 4 ALA A 20 ? ? -154.79 -78.27 51 4 MET A 22 ? ? -123.75 -169.55 52 4 SER A 27 ? ? -166.97 116.01 53 4 PHE A 30 ? ? -153.79 -41.76 54 4 LEU A 32 ? ? 51.86 88.88 55 4 ASN A 34 ? ? -170.30 136.07 56 4 CYS A 36 ? ? -57.72 -174.01 57 4 CYS A 38 ? ? -51.80 173.02 58 4 LEU A 40 ? ? -50.08 -71.61 59 4 LYS A 45 ? ? 177.05 -32.39 60 4 ALA A 47 ? ? -174.76 -75.53 61 4 CYS A 66 ? ? -179.61 147.23 62 5 GLU A 3 ? ? -144.68 43.95 63 5 GLU A 9 ? ? -115.74 -169.91 64 5 ALA A 20 ? ? -178.52 -74.02 65 5 PHE A 30 ? ? -155.47 -41.62 66 5 LEU A 32 ? ? 51.84 88.83 67 5 CYS A 36 ? ? -57.74 -175.53 68 5 CYS A 38 ? ? -47.74 162.70 69 5 ARG A 41 ? ? -176.10 114.98 70 5 THR A 44 ? ? -171.42 -67.03 71 5 LYS A 45 ? ? -154.05 15.50 72 5 GLN A 46 ? ? -117.55 -158.27 73 5 ALA A 47 ? ? 69.87 -164.76 74 6 GLU A 3 ? ? -164.44 -166.13 75 6 ILE A 10 ? ? -113.77 63.27 76 6 ALA A 20 ? ? -178.59 -73.10 77 6 MET A 22 ? ? -167.21 -168.15 78 6 LEU A 32 ? ? 54.91 71.64 79 6 ASN A 34 ? ? -172.25 147.08 80 6 CYS A 36 ? ? -52.19 174.24 81 6 CYS A 38 ? ? -49.33 151.73 82 6 CYS A 39 ? ? -79.48 -166.93 83 6 LEU A 40 ? ? -47.68 -73.83 84 6 LYS A 45 ? ? -177.60 -32.21 85 6 ALA A 47 ? ? -174.12 -73.02 86 7 LYS A 8 ? ? -174.68 79.63 87 7 GLU A 9 ? ? -179.41 -33.98 88 7 ARG A 12 ? ? 59.48 84.86 89 7 ALA A 20 ? ? -179.07 -76.92 90 7 CYS A 21 ? ? -137.98 -41.82 91 7 MET A 22 ? ? -113.48 -168.96 92 7 PHE A 30 ? ? -177.81 -65.35 93 7 LEU A 32 ? ? 55.56 92.46 94 7 CYS A 36 ? ? -51.55 171.15 95 7 TRP A 37 ? ? -112.30 -168.20 96 7 CYS A 39 ? ? -111.81 -165.50 97 7 ARG A 41 ? ? -178.98 123.46 98 7 LYS A 45 ? ? 177.68 -32.76 99 7 ALA A 47 ? ? 180.00 -76.38 100 7 LEU A 69 ? ? -98.24 32.39 101 8 GLU A 3 ? ? -117.28 68.58 102 8 LYS A 4 ? ? -127.66 -52.54 103 8 GLU A 6 ? ? -164.01 -41.27 104 8 LYS A 8 ? ? -172.75 54.78 105 8 ARG A 12 ? ? -115.39 55.13 106 8 ALA A 20 ? ? -179.86 -76.19 107 8 CYS A 21 ? ? -135.34 -39.72 108 8 MET A 22 ? ? -121.88 -168.68 109 8 SER A 27 ? ? -164.28 112.85 110 8 PHE A 30 ? ? -158.38 -41.10 111 8 LEU A 32 ? ? 51.59 86.41 112 8 CYS A 36 ? ? -48.02 164.56 113 8 TRP A 37 ? ? -115.22 -165.85 114 8 CYS A 38 ? ? -44.33 156.78 115 8 CYS A 39 ? ? -119.24 -164.76 116 8 ARG A 41 ? ? -177.70 131.01 117 8 LYS A 45 ? ? 177.79 -32.87 118 8 ALA A 47 ? ? 179.91 -76.59 119 8 PRO A 68 ? ? -69.71 -172.85 120 9 GLU A 3 ? ? -154.59 57.08 121 9 LYS A 4 ? ? 63.27 101.87 122 9 GLU A 6 ? ? 55.12 77.28 123 9 ALA A 20 ? ? -178.69 -75.49 124 9 ASN A 34 ? ? -172.00 144.38 125 9 CYS A 36 ? ? -56.37 -177.84 126 9 CYS A 38 ? ? -53.61 176.74 127 9 CYS A 39 ? ? -117.51 -167.14 128 9 ARG A 41 ? ? -178.49 127.86 129 9 LYS A 45 ? ? 177.64 -32.85 130 9 ALA A 47 ? ? 179.98 -77.54 131 9 CYS A 66 ? ? 178.12 155.21 132 10 PRO A 2 ? ? -69.75 -174.08 133 10 GLU A 3 ? ? -59.92 105.31 134 10 GLU A 9 ? ? -165.87 -167.51 135 10 ILE A 10 ? ? 60.78 76.79 136 10 ALA A 20 ? ? -179.02 -76.05 137 10 PHE A 30 ? ? -163.23 -39.30 138 10 LEU A 32 ? ? 60.05 100.22 139 10 CYS A 36 ? ? -49.27 165.82 140 10 TRP A 37 ? ? -112.68 -168.75 141 10 CYS A 38 ? ? -46.93 156.49 142 10 CYS A 39 ? ? -116.49 -165.31 143 10 LYS A 45 ? ? 176.37 -32.17 144 10 ALA A 47 ? ? -178.67 -69.43 145 10 ASN A 65 ? ? -50.93 109.15 146 11 PRO A 2 ? ? -69.78 -173.76 147 11 MET A 5 ? ? -129.73 -55.17 148 11 GLU A 6 ? ? -160.63 -50.24 149 11 VAL A 7 ? ? 36.15 48.69 150 11 LYS A 8 ? ? -115.47 -169.71 151 11 ARG A 12 ? ? -165.60 86.28 152 11 ALA A 20 ? ? -179.19 -77.52 153 11 CYS A 21 ? ? -141.42 -43.06 154 11 MET A 22 ? ? -107.47 -169.51 155 11 ASN A 34 ? ? -171.08 149.15 156 11 CYS A 36 ? ? -48.84 164.64 157 11 TRP A 37 ? ? -114.95 -167.22 158 11 CYS A 39 ? ? -74.28 -167.43 159 11 LEU A 40 ? ? -51.23 -75.32 160 11 THR A 44 ? ? 178.67 -36.51 161 11 LYS A 45 ? ? -174.23 -33.10 162 11 GLN A 46 ? ? -69.97 -162.27 163 11 ALA A 47 ? ? 71.15 -167.39 164 11 PRO A 68 ? ? -69.77 -175.94 165 12 PRO A 2 ? ? -69.79 -178.89 166 12 LYS A 8 ? ? -174.65 140.45 167 12 ILE A 10 ? ? -115.46 54.81 168 12 ARG A 12 ? ? -155.27 46.08 169 12 PRO A 19 ? ? -69.78 98.57 170 12 ALA A 20 ? ? -126.12 -78.74 171 12 MET A 22 ? ? -127.07 -167.33 172 12 SER A 27 ? ? -167.84 119.44 173 12 ASN A 34 ? ? -173.22 140.20 174 12 CYS A 36 ? ? -56.49 -176.81 175 12 CYS A 39 ? ? -57.71 -174.67 176 12 THR A 44 ? ? -170.94 -37.66 177 12 LYS A 45 ? ? 174.99 -31.01 178 12 ALA A 47 ? ? -174.58 -72.76 179 12 ASN A 65 ? ? -51.50 103.43 180 12 PRO A 68 ? ? -69.78 -178.54 181 13 PRO A 2 ? ? -69.77 -172.28 182 13 GLU A 6 ? ? -135.25 -67.43 183 13 VAL A 7 ? ? -174.64 147.61 184 13 GLU A 9 ? ? -153.83 -76.65 185 13 ALA A 20 ? ? -175.16 -78.45 186 13 LEU A 32 ? ? 55.87 93.40 187 13 ASN A 34 ? ? -168.48 116.56 188 13 CYS A 36 ? ? -56.26 -178.65 189 13 CYS A 38 ? ? -57.60 -175.31 190 13 LYS A 45 ? ? 177.51 -32.42 191 13 ALA A 47 ? ? -176.32 -82.14 192 13 ASN A 65 ? ? -50.08 104.21 193 14 PRO A 2 ? ? -69.80 -173.85 194 14 MET A 5 ? ? -145.94 -49.01 195 14 LYS A 8 ? ? -176.99 -178.09 196 14 ILE A 10 ? ? -97.63 57.21 197 14 ALA A 20 ? ? -178.43 -72.76 198 14 SER A 27 ? ? -165.64 117.16 199 14 PHE A 30 ? ? -154.32 -41.81 200 14 LEU A 32 ? ? 57.33 95.37 201 14 ASN A 34 ? ? -170.50 133.72 202 14 CYS A 36 ? ? -58.38 -172.72 203 14 CYS A 39 ? ? -59.72 -174.69 204 14 THR A 44 ? ? -131.49 -38.72 205 14 LYS A 45 ? ? 175.78 -32.07 206 14 ALA A 47 ? ? 179.48 -78.04 207 14 ASN A 65 ? ? -49.79 103.46 208 15 LYS A 4 ? ? 62.27 170.64 209 15 LYS A 8 ? ? -171.75 120.98 210 15 ARG A 12 ? ? -152.61 64.54 211 15 ALA A 20 ? ? -178.75 -78.84 212 15 CYS A 21 ? ? -132.84 -38.42 213 15 MET A 22 ? ? -120.49 -169.82 214 15 PHE A 30 ? ? -103.30 -69.01 215 15 LEU A 32 ? ? 55.60 93.18 216 15 ASN A 34 ? ? -170.08 148.84 217 15 CYS A 36 ? ? -54.06 176.64 218 15 LEU A 40 ? ? 51.90 -168.71 219 15 LYS A 45 ? ? -177.12 -31.99 220 15 ALA A 47 ? ? -179.12 -69.66 221 15 CYS A 66 ? ? 177.26 145.89 222 16 PRO A 2 ? ? -69.77 -172.87 223 16 ALA A 20 ? ? -173.53 -78.34 224 16 CYS A 21 ? ? -133.77 -40.69 225 16 SER A 27 ? ? -167.68 118.93 226 16 PHE A 30 ? ? -154.97 -41.71 227 16 LEU A 32 ? ? 56.13 93.46 228 16 ASN A 34 ? ? -170.38 131.34 229 16 CYS A 36 ? ? -56.63 -177.24 230 16 CYS A 38 ? ? -57.73 -175.50 231 16 THR A 44 ? ? -173.56 -46.06 232 16 LYS A 45 ? ? -175.09 -33.28 233 16 GLN A 46 ? ? -38.71 -71.09 234 16 ALA A 47 ? ? 65.18 111.10 235 16 ASN A 65 ? ? -51.19 104.60 236 17 PRO A 2 ? ? -69.79 -176.81 237 17 ARG A 12 ? ? 58.79 77.98 238 17 SER A 13 ? ? -70.73 -169.90 239 17 SER A 14 ? ? -99.67 31.86 240 17 ALA A 20 ? ? -179.08 -77.07 241 17 CYS A 21 ? ? -136.98 -42.44 242 17 MET A 22 ? ? -113.44 -168.68 243 17 PHE A 30 ? ? -155.75 -41.60 244 17 LEU A 32 ? ? 51.84 88.83 245 17 CYS A 36 ? ? -51.63 171.01 246 17 TRP A 37 ? ? -120.96 -165.46 247 17 CYS A 38 ? ? -43.51 155.21 248 17 CYS A 39 ? ? -127.87 -162.87 249 17 ARG A 41 ? ? -179.12 123.16 250 17 LYS A 45 ? ? 177.81 -32.06 251 17 ALA A 47 ? ? -179.56 -76.28 252 18 PRO A 2 ? ? -69.79 -171.56 253 18 GLU A 6 ? ? -172.01 125.83 254 18 LYS A 8 ? ? -166.88 100.11 255 18 GLU A 9 ? ? -119.81 -169.60 256 18 ALA A 20 ? ? -179.18 -75.60 257 18 CYS A 21 ? ? -143.30 -41.81 258 18 MET A 22 ? ? -108.83 -168.91 259 18 LEU A 32 ? ? 56.06 71.84 260 18 ASN A 34 ? ? -172.70 149.08 261 18 CYS A 36 ? ? -51.62 172.12 262 18 TRP A 37 ? ? -117.10 -167.84 263 18 CYS A 38 ? ? -43.71 154.62 264 18 CYS A 39 ? ? -107.88 -165.40 265 18 LYS A 45 ? ? 176.06 -33.39 266 18 ALA A 47 ? ? 177.36 -76.37 267 18 LEU A 69 ? ? -109.16 41.68 268 19 GLU A 3 ? ? -52.31 105.69 269 19 LYS A 8 ? ? -122.89 -169.89 270 19 ILE A 10 ? ? -96.50 59.41 271 19 ALA A 20 ? ? 179.63 -77.16 272 19 CYS A 21 ? ? -150.89 18.99 273 19 MET A 22 ? ? -169.67 -168.26 274 19 PHE A 30 ? ? -153.41 -41.98 275 19 LEU A 32 ? ? 51.81 88.55 276 19 CYS A 36 ? ? -46.19 162.31 277 19 CYS A 38 ? ? -50.43 103.20 278 19 LYS A 43 ? ? -143.47 13.49 279 19 THR A 44 ? ? -178.98 -41.42 280 19 LYS A 45 ? ? -174.87 -34.27 281 19 GLN A 46 ? ? -57.14 -174.36 282 19 ALA A 47 ? ? -174.75 124.02 283 20 PRO A 2 ? ? -69.75 -175.81 284 20 GLU A 3 ? ? -59.69 103.13 285 20 ARG A 12 ? ? -103.67 55.44 286 20 SER A 14 ? ? -99.65 34.54 287 20 PRO A 19 ? ? -69.80 97.82 288 20 ALA A 20 ? ? -135.42 -60.54 289 20 MET A 22 ? ? -176.79 -88.75 290 20 PHE A 30 ? ? -149.92 18.30 291 20 SER A 31 ? ? -145.64 -41.83 292 20 CYS A 36 ? ? -53.64 178.20 293 20 CYS A 39 ? ? -65.54 -175.28 294 20 LYS A 45 ? ? 177.42 -32.96 295 20 ALA A 47 ? ? 179.52 -77.35 296 20 CYS A 66 ? ? 179.24 154.55 297 20 PRO A 68 ? ? -69.77 -173.81 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RU1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RU1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-99% 13C; U-99% 15N] entity-1, 50 mM sodium phosphate-2, 50 mM potassium chloride-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-99% 13C; U-99% 15N] entity-4, 50 mM sodium phosphate-5, 50 mM potassium chloride-6, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-2' 50 ? mM ? 1 'potassium chloride-3' 50 ? mM ? 1 entity-4 1 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium phosphate-5' 50 ? mM ? 2 'potassium chloride-6' 50 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N NOESY' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D C(CO)NH' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D HBHA(CO)NH' 1 8 2 '2D 1H-13C HSQC' 1 9 2 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2RU1 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 ? Goddard 'chemical shift assignment' Sparky 3 ? ? refinement CYANA 4 ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2RU1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_