data_2RUE
# 
_entry.id   2RUE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2RUE         pdb_00002rue 10.2210/pdb2rue/pdb 
RCSB  RCSB150278   ?            ?                   
BMRB  11561        ?            10.13018/BMR11561   
WWPDB D_1000150278 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-05-20 
2 'Structure model' 1 1 2015-08-05 
3 'Structure model' 1 2 2015-08-26 
4 'Structure model' 1 3 2022-08-24 
5 'Structure model' 1 4 2023-06-14 
6 'Structure model' 1 5 2024-11-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Data collection'     
4 4 'Structure model' 'Database references' 
5 5 'Structure model' Other                 
6 6 'Structure model' 'Data collection'     
7 6 'Structure model' 'Database references' 
8 6 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation                  
2  4 'Structure model' database_2                
3  4 'Structure model' pdbx_nmr_software         
4  4 'Structure model' pdbx_nmr_spectrometer     
5  4 'Structure model' struct_ref_seq_dif        
6  5 'Structure model' pdbx_database_status      
7  6 'Structure model' chem_comp_atom            
8  6 'Structure model' chem_comp_bond            
9  6 'Structure model' database_2                
10 6 'Structure model' pdbx_entry_details        
11 6 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_volume'                   
2  4 'Structure model' '_citation.page_first'                       
3  4 'Structure model' '_citation.page_last'                        
4  4 'Structure model' '_citation.title'                            
5  4 'Structure model' '_database_2.pdbx_DOI'                       
6  4 'Structure model' '_database_2.pdbx_database_accession'        
7  4 'Structure model' '_pdbx_nmr_software.name'                    
8  4 'Structure model' '_pdbx_nmr_spectrometer.model'               
9  4 'Structure model' '_struct_ref_seq_dif.details'                
10 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
11 6 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2RUE 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2014-03-27 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2kp1  PDB  . 
unspecified 2kp2  PDB  . 
unspecified 11561 BMRB . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Inagaki, K.' 1 
'Satoh, T.'   2 
'Kato, K.'    3 
# 
_citation.id                        primary 
_citation.title                     
;Redox-coupled structural changes of the catalytic a' domain of protein disulfide isomerase.
;
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            589 
_citation.page_first                2690 
_citation.page_last                 2694 
_citation.year                      2015 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26272828 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2015.07.041 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Inagaki, K.'       1 ? 
primary 'Satoh, T.'         2 ? 
primary 'Yagi-Utsumi, M.'   3 ? 
primary 'Le Gulluche, A.C.' 4 ? 
primary 'Anzai, T.'         5 ? 
primary 'Uekusa, Y.'        6 ? 
primary 'Kamiya, Y.'        7 ? 
primary 'Kato, K.'          8 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Protein disulfide-isomerase' 
_entity.formula_weight             13123.905 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    5.3.4.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 354-469' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PDI 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQ
GFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSEGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQ
GFPTIKLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   GLU n 
1 7   GLY n 
1 8   PRO n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  VAL n 
1 13  VAL n 
1 14  ALA n 
1 15  LYS n 
1 16  ASN n 
1 17  TYR n 
1 18  ASN n 
1 19  GLU n 
1 20  ILE n 
1 21  VAL n 
1 22  LEU n 
1 23  ASP n 
1 24  ASP n 
1 25  THR n 
1 26  LYS n 
1 27  ASP n 
1 28  VAL n 
1 29  LEU n 
1 30  ILE n 
1 31  GLU n 
1 32  PHE n 
1 33  TYR n 
1 34  ALA n 
1 35  PRO n 
1 36  TRP n 
1 37  CYS n 
1 38  GLY n 
1 39  HIS n 
1 40  CYS n 
1 41  LYS n 
1 42  ALA n 
1 43  LEU n 
1 44  ALA n 
1 45  PRO n 
1 46  LYS n 
1 47  TYR n 
1 48  GLU n 
1 49  GLU n 
1 50  LEU n 
1 51  GLY n 
1 52  ALA n 
1 53  LEU n 
1 54  TYR n 
1 55  ALA n 
1 56  LYS n 
1 57  SER n 
1 58  GLU n 
1 59  PHE n 
1 60  LYS n 
1 61  ASP n 
1 62  ARG n 
1 63  VAL n 
1 64  VAL n 
1 65  ILE n 
1 66  ALA n 
1 67  LYS n 
1 68  VAL n 
1 69  ASP n 
1 70  ALA n 
1 71  THR n 
1 72  ALA n 
1 73  ASN n 
1 74  ASP n 
1 75  VAL n 
1 76  PRO n 
1 77  ASP n 
1 78  GLU n 
1 79  ILE n 
1 80  GLN n 
1 81  GLY n 
1 82  PHE n 
1 83  PRO n 
1 84  THR n 
1 85  ILE n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  PRO n 
1 90  ALA n 
1 91  GLY n 
1 92  ALA n 
1 93  LYS n 
1 94  GLY n 
1 95  GLN n 
1 96  PRO n 
1 97  VAL n 
1 98  THR n 
1 99  TYR n 
1 100 SER n 
1 101 GLY n 
1 102 SER n 
1 103 ARG n 
1 104 THR n 
1 105 VAL n 
1 106 GLU n 
1 107 ASP n 
1 108 LEU n 
1 109 ILE n 
1 110 LYS n 
1 111 PHE n 
1 112 ILE n 
1 113 ALA n 
1 114 GLU n 
1 115 ASN n 
1 116 GLY n 
1 117 LYS n 
1 118 TYR n 
1 119 LYS n 
1 120 ALA n 
1 121 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Soft-rot fungus' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Humicola insolens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     34413 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pGEX6P-1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  ASN 16  16  16  ASN ASN A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ASP 24  24  24  ASP ASP A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  TRP 36  36  36  TRP TRP A . n 
A 1 37  CYS 37  37  37  CYS CYS A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  CYS 40  40  40  CYS CYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  TYR 47  47  47  TYR TYR A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  TYR 54  54  54  TYR TYR A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  LYS 56  56  56  LYS LYS A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  PHE 59  59  59  PHE PHE A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ARG 62  62  62  ARG ARG A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2RUE 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2RUE 
_struct.title                     
;Solution structure of the a' domain of thermophilic fungal protein disulfide (oxidized form, 303K)
;
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2RUE 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'THIOREDOXIN FOLD, ISOMERASE, DISULFIDE BOND, ENDOPLASMIC RETICULUM, REDOX-ACTIVE CENTER' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDI_HUMIN 
_struct_ref.pdbx_db_accession          P55059 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGPVTVVVAKNYNEIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYAKSEFKDRVVIAKVDATANDVPDEIQGFPTI
KLYPAGAKGQPVTYSGSRTVEDLIKFIAENGKYKAA
;
_struct_ref.pdbx_align_begin           354 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2RUE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 121 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P55059 
_struct_ref_seq.db_align_beg                  354 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  469 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       6 
_struct_ref_seq.pdbx_auth_seq_align_end       121 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2RUE GLY A 1 ? UNP P55059 ? ? 'expression tag' 1 1 
1 2RUE PRO A 2 ? UNP P55059 ? ? 'expression tag' 2 2 
1 2RUE LEU A 3 ? UNP P55059 ? ? 'expression tag' 3 3 
1 2RUE GLY A 4 ? UNP P55059 ? ? 'expression tag' 4 4 
1 2RUE SER A 5 ? UNP P55059 ? ? 'expression tag' 5 5 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 13  ? ASP A 23  ? VAL A 13  ASP A 23  1 ? 11 
HELX_P HELX_P2 2 ALA A 42  ? SER A 57  ? ALA A 42  SER A 57  1 ? 16 
HELX_P HELX_P3 3 THR A 104 ? GLY A 116 ? THR A 104 GLY A 116 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            37 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            40 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             37 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             40 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.031 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      CYS 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       37 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      40 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       CYS 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        37 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       40 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               SG 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                . 
_pdbx_modification_feature.ref_pcm_id                         . 
_pdbx_modification_feature.ref_comp_id                        . 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 63 ? ASP A 69 ? VAL A 63 ASP A 69 
A 2 ASP A 27 ? TYR A 33 ? ASP A 27 TYR A 33 
A 3 THR A 84 ? TYR A 88 ? THR A 84 TYR A 88 
A 4 VAL A 97 ? THR A 98 ? VAL A 97 THR A 98 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 66 ? O ALA A 66 N LEU A 29 ? N LEU A 29 
A 2 3 N ILE A 30 ? N ILE A 30 O LYS A 86 ? O LYS A 86 
A 3 4 N LEU A 87 ? N LEU A 87 O VAL A 97 ? O VAL A 97 
# 
_pdbx_entry_details.entry_id                   2RUE 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 2 O A VAL 13 ? ? H A TYR 17 ? ? 1.58 
2 3 O A VAL 13 ? ? H A TYR 17 ? ? 1.56 
3 6 O A VAL 13 ? ? H A TYR 17 ? ? 1.57 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  SER A 57  ? ? -58.22  -173.88 
2  1  GLU A 58  ? ? -95.54  43.36   
3  1  ALA A 70  ? ? -88.11  48.31   
4  1  PRO A 83  ? ? -65.91  78.52   
5  1  ARG A 103 ? ? -175.55 -42.98  
6  2  SER A 57  ? ? -58.00  -173.81 
7  2  GLU A 58  ? ? -97.06  30.94   
8  2  ARG A 62  ? ? -84.21  -75.15  
9  2  ALA A 70  ? ? -85.57  46.04   
10 2  PRO A 76  ? ? -72.65  -73.50  
11 2  ASP A 77  ? ? 44.10   93.49   
12 2  LYS A 93  ? ? -57.13  -168.15 
13 2  TYR A 99  ? ? -66.33  -175.91 
14 2  ARG A 103 ? ? -158.14 -56.78  
15 3  PRO A 2   ? ? -52.24  172.69  
16 3  SER A 57  ? ? -58.91  176.56  
17 3  PHE A 59  ? ? -95.96  38.17   
18 3  PRO A 76  ? ? -69.76  78.34   
19 3  PRO A 83  ? ? -67.75  80.35   
20 3  LYS A 93  ? ? -60.17  -173.49 
21 3  ARG A 103 ? ? -148.19 -72.99  
22 3  ALA A 120 ? ? 61.83   90.35   
23 4  ASP A 23  ? ? -58.75  96.24   
24 4  LYS A 26  ? ? -176.94 145.10  
25 4  LYS A 56  ? ? -97.38  38.18   
26 4  PHE A 59  ? ? -95.29  38.24   
27 4  PRO A 76  ? ? -66.29  78.59   
28 4  ASP A 77  ? ? -104.38 74.20   
29 4  PRO A 83  ? ? -66.60  80.97   
30 4  ARG A 103 ? ? -139.72 -47.05  
31 4  ALA A 120 ? ? 61.63   115.43  
32 5  LEU A 3   ? ? 57.37   173.05  
33 5  LYS A 26  ? ? -172.88 131.45  
34 5  LYS A 56  ? ? -97.10  36.35   
35 5  PHE A 59  ? ? -97.13  35.80   
36 5  ARG A 62  ? ? -116.90 -74.64  
37 5  ASP A 77  ? ? 42.12   83.43   
38 5  LYS A 93  ? ? -56.02  -170.87 
39 5  ARG A 103 ? ? -145.22 -66.82  
40 6  ASP A 23  ? ? -58.88  104.31  
41 6  LYS A 26  ? ? -177.03 137.99  
42 6  LYS A 56  ? ? -98.33  35.90   
43 6  PHE A 59  ? ? -96.63  38.20   
44 6  PRO A 76  ? ? -69.28  79.23   
45 6  PRO A 83  ? ? -63.98  81.21   
46 6  ALA A 92  ? ? -140.44 47.47   
47 6  ARG A 103 ? ? -147.37 -77.31  
48 7  LEU A 3   ? ? -130.70 -59.80  
49 7  SER A 57  ? ? -59.71  -173.89 
50 7  GLU A 58  ? ? -96.16  42.21   
51 7  ALA A 70  ? ? -83.09  47.65   
52 7  PRO A 76  ? ? -69.89  79.02   
53 7  LYS A 93  ? ? -58.57  -173.27 
54 7  TYR A 99  ? ? -64.43  -176.37 
55 7  ARG A 103 ? ? -159.78 -67.74  
56 8  PRO A 2   ? ? -52.31  -177.18 
57 8  LYS A 56  ? ? -95.48  37.79   
58 8  GLU A 58  ? ? -95.46  37.32   
59 8  ALA A 70  ? ? -90.48  44.48   
60 8  PRO A 83  ? ? -68.39  76.44   
61 8  LYS A 93  ? ? -59.17  -170.00 
62 8  TYR A 99  ? ? -66.32  -178.24 
63 8  ARG A 103 ? ? -154.36 26.41   
64 8  ALA A 120 ? ? 57.31   92.15   
65 9  LYS A 26  ? ? -173.49 143.14  
66 9  LYS A 56  ? ? -97.38  32.56   
67 9  PRO A 76  ? ? -67.71  78.29   
68 9  PRO A 83  ? ? -66.38  75.90   
69 9  LYS A 93  ? ? -55.36  -173.94 
70 9  TYR A 99  ? ? -68.55  -178.36 
71 9  ARG A 103 ? ? 179.60  -35.94  
72 9  ALA A 120 ? ? 60.59   87.30   
73 10 ASP A 23  ? ? -57.70  105.06  
74 10 LYS A 56  ? ? -96.29  38.18   
75 10 PHE A 59  ? ? -96.91  38.19   
76 10 ARG A 62  ? ? -120.50 -55.73  
77 10 PRO A 76  ? ? -69.15  79.27   
78 10 PRO A 83  ? ? -62.53  78.49   
79 10 TYR A 99  ? ? -69.35  -176.35 
80 10 ARG A 103 ? ? -165.51 -66.25  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2RUE 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2RUE 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.1 mM [U-15N] PDI-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'0.1 mM [U-13C; U-15N] PDI-2, 100% D2O' 2 '100% D2O'        
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
PDI-1 0.1 ? mM '[U-15N]'        1 
PDI-2 0.1 ? mM '[U-13C; U-15N]' 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.16 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'            
1 2 1 '3D 1H-15N NOESY'           
1 3 2 '2D 1H-13C HSQC aliphatic'  
1 4 2 '2D 1H-13C HSQC aromatic'   
1 5 2 '3D 1H-13C NOESY aliphatic' 
1 6 2 '2D 1H-1H NOESY'            
# 
_pdbx_nmr_refine.entry_id           2RUE 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Brunger, Adams, Clore, Gros, Nilges and Read' refinement                  CNS     1 1.3 
'Guntert, Mumenthaler and Wuthrich'            refinement                  CYANA   2 3.0 
Goddard                                        'chemical shift assignment' Sparky  3 3.1 
'Bruker Biospin'                               processing                  XwinNMR 4 2.6 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
PHE N    N N N 227 
PHE CA   C N S 228 
PHE C    C N N 229 
PHE O    O N N 230 
PHE CB   C N N 231 
PHE CG   C Y N 232 
PHE CD1  C Y N 233 
PHE CD2  C Y N 234 
PHE CE1  C Y N 235 
PHE CE2  C Y N 236 
PHE CZ   C Y N 237 
PHE OXT  O N N 238 
PHE H    H N N 239 
PHE H2   H N N 240 
PHE HA   H N N 241 
PHE HB2  H N N 242 
PHE HB3  H N N 243 
PHE HD1  H N N 244 
PHE HD2  H N N 245 
PHE HE1  H N N 246 
PHE HE2  H N N 247 
PHE HZ   H N N 248 
PHE HXT  H N N 249 
PRO N    N N N 250 
PRO CA   C N S 251 
PRO C    C N N 252 
PRO O    O N N 253 
PRO CB   C N N 254 
PRO CG   C N N 255 
PRO CD   C N N 256 
PRO OXT  O N N 257 
PRO H    H N N 258 
PRO HA   H N N 259 
PRO HB2  H N N 260 
PRO HB3  H N N 261 
PRO HG2  H N N 262 
PRO HG3  H N N 263 
PRO HD2  H N N 264 
PRO HD3  H N N 265 
PRO HXT  H N N 266 
SER N    N N N 267 
SER CA   C N S 268 
SER C    C N N 269 
SER O    O N N 270 
SER CB   C N N 271 
SER OG   O N N 272 
SER OXT  O N N 273 
SER H    H N N 274 
SER H2   H N N 275 
SER HA   H N N 276 
SER HB2  H N N 277 
SER HB3  H N N 278 
SER HG   H N N 279 
SER HXT  H N N 280 
THR N    N N N 281 
THR CA   C N S 282 
THR C    C N N 283 
THR O    O N N 284 
THR CB   C N R 285 
THR OG1  O N N 286 
THR CG2  C N N 287 
THR OXT  O N N 288 
THR H    H N N 289 
THR H2   H N N 290 
THR HA   H N N 291 
THR HB   H N N 292 
THR HG1  H N N 293 
THR HG21 H N N 294 
THR HG22 H N N 295 
THR HG23 H N N 296 
THR HXT  H N N 297 
TRP N    N N N 298 
TRP CA   C N S 299 
TRP C    C N N 300 
TRP O    O N N 301 
TRP CB   C N N 302 
TRP CG   C Y N 303 
TRP CD1  C Y N 304 
TRP CD2  C Y N 305 
TRP NE1  N Y N 306 
TRP CE2  C Y N 307 
TRP CE3  C Y N 308 
TRP CZ2  C Y N 309 
TRP CZ3  C Y N 310 
TRP CH2  C Y N 311 
TRP OXT  O N N 312 
TRP H    H N N 313 
TRP H2   H N N 314 
TRP HA   H N N 315 
TRP HB2  H N N 316 
TRP HB3  H N N 317 
TRP HD1  H N N 318 
TRP HE1  H N N 319 
TRP HE3  H N N 320 
TRP HZ2  H N N 321 
TRP HZ3  H N N 322 
TRP HH2  H N N 323 
TRP HXT  H N N 324 
TYR N    N N N 325 
TYR CA   C N S 326 
TYR C    C N N 327 
TYR O    O N N 328 
TYR CB   C N N 329 
TYR CG   C Y N 330 
TYR CD1  C Y N 331 
TYR CD2  C Y N 332 
TYR CE1  C Y N 333 
TYR CE2  C Y N 334 
TYR CZ   C Y N 335 
TYR OH   O N N 336 
TYR OXT  O N N 337 
TYR H    H N N 338 
TYR H2   H N N 339 
TYR HA   H N N 340 
TYR HB2  H N N 341 
TYR HB3  H N N 342 
TYR HD1  H N N 343 
TYR HD2  H N N 344 
TYR HE1  H N N 345 
TYR HE2  H N N 346 
TYR HH   H N N 347 
TYR HXT  H N N 348 
VAL N    N N N 349 
VAL CA   C N S 350 
VAL C    C N N 351 
VAL O    O N N 352 
VAL CB   C N N 353 
VAL CG1  C N N 354 
VAL CG2  C N N 355 
VAL OXT  O N N 356 
VAL H    H N N 357 
VAL H2   H N N 358 
VAL HA   H N N 359 
VAL HB   H N N 360 
VAL HG11 H N N 361 
VAL HG12 H N N 362 
VAL HG13 H N N 363 
VAL HG21 H N N 364 
VAL HG22 H N N 365 
VAL HG23 H N N 366 
VAL HXT  H N N 367 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
PHE N   CA   sing N N 216 
PHE N   H    sing N N 217 
PHE N   H2   sing N N 218 
PHE CA  C    sing N N 219 
PHE CA  CB   sing N N 220 
PHE CA  HA   sing N N 221 
PHE C   O    doub N N 222 
PHE C   OXT  sing N N 223 
PHE CB  CG   sing N N 224 
PHE CB  HB2  sing N N 225 
PHE CB  HB3  sing N N 226 
PHE CG  CD1  doub Y N 227 
PHE CG  CD2  sing Y N 228 
PHE CD1 CE1  sing Y N 229 
PHE CD1 HD1  sing N N 230 
PHE CD2 CE2  doub Y N 231 
PHE CD2 HD2  sing N N 232 
PHE CE1 CZ   doub Y N 233 
PHE CE1 HE1  sing N N 234 
PHE CE2 CZ   sing Y N 235 
PHE CE2 HE2  sing N N 236 
PHE CZ  HZ   sing N N 237 
PHE OXT HXT  sing N N 238 
PRO N   CA   sing N N 239 
PRO N   CD   sing N N 240 
PRO N   H    sing N N 241 
PRO CA  C    sing N N 242 
PRO CA  CB   sing N N 243 
PRO CA  HA   sing N N 244 
PRO C   O    doub N N 245 
PRO C   OXT  sing N N 246 
PRO CB  CG   sing N N 247 
PRO CB  HB2  sing N N 248 
PRO CB  HB3  sing N N 249 
PRO CG  CD   sing N N 250 
PRO CG  HG2  sing N N 251 
PRO CG  HG3  sing N N 252 
PRO CD  HD2  sing N N 253 
PRO CD  HD3  sing N N 254 
PRO OXT HXT  sing N N 255 
SER N   CA   sing N N 256 
SER N   H    sing N N 257 
SER N   H2   sing N N 258 
SER CA  C    sing N N 259 
SER CA  CB   sing N N 260 
SER CA  HA   sing N N 261 
SER C   O    doub N N 262 
SER C   OXT  sing N N 263 
SER CB  OG   sing N N 264 
SER CB  HB2  sing N N 265 
SER CB  HB3  sing N N 266 
SER OG  HG   sing N N 267 
SER OXT HXT  sing N N 268 
THR N   CA   sing N N 269 
THR N   H    sing N N 270 
THR N   H2   sing N N 271 
THR CA  C    sing N N 272 
THR CA  CB   sing N N 273 
THR CA  HA   sing N N 274 
THR C   O    doub N N 275 
THR C   OXT  sing N N 276 
THR CB  OG1  sing N N 277 
THR CB  CG2  sing N N 278 
THR CB  HB   sing N N 279 
THR OG1 HG1  sing N N 280 
THR CG2 HG21 sing N N 281 
THR CG2 HG22 sing N N 282 
THR CG2 HG23 sing N N 283 
THR OXT HXT  sing N N 284 
TRP N   CA   sing N N 285 
TRP N   H    sing N N 286 
TRP N   H2   sing N N 287 
TRP CA  C    sing N N 288 
TRP CA  CB   sing N N 289 
TRP CA  HA   sing N N 290 
TRP C   O    doub N N 291 
TRP C   OXT  sing N N 292 
TRP CB  CG   sing N N 293 
TRP CB  HB2  sing N N 294 
TRP CB  HB3  sing N N 295 
TRP CG  CD1  doub Y N 296 
TRP CG  CD2  sing Y N 297 
TRP CD1 NE1  sing Y N 298 
TRP CD1 HD1  sing N N 299 
TRP CD2 CE2  doub Y N 300 
TRP CD2 CE3  sing Y N 301 
TRP NE1 CE2  sing Y N 302 
TRP NE1 HE1  sing N N 303 
TRP CE2 CZ2  sing Y N 304 
TRP CE3 CZ3  doub Y N 305 
TRP CE3 HE3  sing N N 306 
TRP CZ2 CH2  doub Y N 307 
TRP CZ2 HZ2  sing N N 308 
TRP CZ3 CH2  sing Y N 309 
TRP CZ3 HZ3  sing N N 310 
TRP CH2 HH2  sing N N 311 
TRP OXT HXT  sing N N 312 
TYR N   CA   sing N N 313 
TYR N   H    sing N N 314 
TYR N   H2   sing N N 315 
TYR CA  C    sing N N 316 
TYR CA  CB   sing N N 317 
TYR CA  HA   sing N N 318 
TYR C   O    doub N N 319 
TYR C   OXT  sing N N 320 
TYR CB  CG   sing N N 321 
TYR CB  HB2  sing N N 322 
TYR CB  HB3  sing N N 323 
TYR CG  CD1  doub Y N 324 
TYR CG  CD2  sing Y N 325 
TYR CD1 CE1  sing Y N 326 
TYR CD1 HD1  sing N N 327 
TYR CD2 CE2  doub Y N 328 
TYR CD2 HD2  sing N N 329 
TYR CE1 CZ   doub Y N 330 
TYR CE1 HE1  sing N N 331 
TYR CE2 CZ   sing Y N 332 
TYR CE2 HE2  sing N N 333 
TYR CZ  OH   sing N N 334 
TYR OH  HH   sing N N 335 
TYR OXT HXT  sing N N 336 
VAL N   CA   sing N N 337 
VAL N   H    sing N N 338 
VAL N   H2   sing N N 339 
VAL CA  C    sing N N 340 
VAL CA  CB   sing N N 341 
VAL CA  HA   sing N N 342 
VAL C   O    doub N N 343 
VAL C   OXT  sing N N 344 
VAL CB  CG1  sing N N 345 
VAL CB  CG2  sing N N 346 
VAL CB  HB   sing N N 347 
VAL CG1 HG11 sing N N 348 
VAL CG1 HG12 sing N N 349 
VAL CG1 HG13 sing N N 350 
VAL CG2 HG21 sing N N 351 
VAL CG2 HG22 sing N N 352 
VAL CG2 HG23 sing N N 353 
VAL OXT HXT  sing N N 354 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker AVANCE 1 'Bruker Avance' 
920 JEOL   ECA    2 'JEOL ECA'      
# 
_atom_sites.entry_id                    2RUE 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_