data_2RV6 # _entry.id 2RV6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB150305 RCSB 2RV6 PDB 11488 BMRB D_1000150305 WWPDB # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2RSJ PDB 'BMRB Entry Tracking System' unspecified 11488 BMRB . unspecified 2RUT PDB . unspecified 2RUU PDB . unspecified 2RUV PDB . unspecified 2RUW PDB . unspecified 2RUX PDB . unspecified 2RUY PDB . unspecified 2RUZ PDB . unspecified 2RV0 PDB . unspecified 2RV1 PDB . unspecified 2RV2 PDB . unspecified 2RV3 PDB . unspecified 2RV4 PDB . unspecified 2RV5 PDB . unspecified 2RV7 PDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RV6 _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-01-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Umehara, T.' 2 'Kigawa, T.' 3 'Yokoyama, S.' 4 # _citation.id primary _citation.title 'Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT' _citation.journal_abbrev J.Struct.Funct.Genom. _citation.journal_volume 16 _citation.page_first 55 _citation.page_last 65 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1345-711X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25801860 _citation.pdbx_database_id_DOI 10.1007/s10969-015-9196-3 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tochio, N.' 1 primary 'Umehara, T.' 2 primary 'Nakabayashi, K.' 3 primary 'Yoneyama, M.' 4 primary 'Tsuda, K.' 5 primary 'Shirouzu, M.' 6 primary 'Koshiba, S.' 7 primary 'Watanabe, S.' 8 primary 'Kigawa, T.' 9 primary 'Sasazuki, T.' 10 primary 'Shirasawa, S.' 11 primary 'Yokoyama, S.' 12 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein ZFAT' 10522.319 1 ? ? 'UNP residues 269-353' ? 2 non-polymer syn 'ZINC ION' 65.409 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger gene in AITD susceptibility region, Zinc finger protein 406' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHL KVHIERVHKKIK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGKIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHL KVHIERVHKKIK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 LYS n 1 9 ILE n 1 10 PHE n 1 11 THR n 1 12 CYS n 1 13 GLU n 1 14 TYR n 1 15 CYS n 1 16 ASN n 1 17 LYS n 1 18 VAL n 1 19 PHE n 1 20 LYS n 1 21 PHE n 1 22 LYS n 1 23 HIS n 1 24 SER n 1 25 LEU n 1 26 GLN n 1 27 ALA n 1 28 HIS n 1 29 LEU n 1 30 ARG n 1 31 ILE n 1 32 HIS n 1 33 THR n 1 34 ASN n 1 35 GLU n 1 36 LYS n 1 37 PRO n 1 38 TYR n 1 39 LYS n 1 40 CYS n 1 41 PRO n 1 42 GLN n 1 43 CYS n 1 44 SER n 1 45 TYR n 1 46 ALA n 1 47 SER n 1 48 ALA n 1 49 ILE n 1 50 LYS n 1 51 ALA n 1 52 ASN n 1 53 LEU n 1 54 ASN n 1 55 VAL n 1 56 HIS n 1 57 LEU n 1 58 ARG n 1 59 LYS n 1 60 HIS n 1 61 THR n 1 62 GLY n 1 63 GLU n 1 64 LYS n 1 65 PHE n 1 66 ALA n 1 67 CYS n 1 68 ASP n 1 69 TYR n 1 70 CYS n 1 71 SER n 1 72 PHE n 1 73 THR n 1 74 CYS n 1 75 LEU n 1 76 SER n 1 77 LYS n 1 78 GLY n 1 79 HIS n 1 80 LEU n 1 81 LYS n 1 82 VAL n 1 83 HIS n 1 84 ILE n 1 85 GLU n 1 86 ARG n 1 87 VAL n 1 88 HIS n 1 89 LYS n 1 90 LYS n 1 91 ILE n 1 92 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ZFAT, KIAA1485, ZFAT1, ZNF406' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector P061010-07 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZFAT_HUMAN _struct_ref.pdbx_db_accession Q9P243 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KIFTCEYCNKVFKFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERV HKKIK ; _struct_ref.pdbx_align_begin 269 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RV6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P243 _struct_ref_seq.db_align_beg 269 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 353 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 92 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RV6 GLY A 1 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 1 1 1 2RV6 SER A 2 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 2 2 1 2RV6 SER A 3 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 3 3 1 2RV6 GLY A 4 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 4 4 1 2RV6 SER A 5 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 5 5 1 2RV6 SER A 6 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 6 6 1 2RV6 GLY A 7 ? UNP Q9P243 ? ? 'EXPRESSION TAG' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.59 mM [U-13C; U-15N] protein-1, 20 mM [U-2H] TRIS-2, 100 mM sodium chloride-3, 1 mM [U-2H] DTT-4, 0.02 % sodium azide-5, 50 uM zinc chloride-6, 90 % H2O-7, 10 % [U-2H] D2O-8, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RV6 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RV6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RV6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' collection XWINNMR 1 ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2 ? 'Johnson, One Moon Scientific' 'data analysis' NMRView 3 ? 'N. Kobayashi' 'data analysis' Kujira 4 ? 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 5 ? 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' 'structure solution' AMBER 6 ? 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement AMBER 7 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RV6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RV6 _struct.title 'Solution structures of the DNA-binding domains (ZF2-ZF3-ZF4) of immune-related zinc-finger protein ZFAT' _struct.pdbx_descriptor 'Zinc finger protein ZFAT' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RV6 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'ZFAT, zinc finger, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 21 ? ASN A 34 ? PHE A 21 ASN A 34 1 ? 14 HELX_P HELX_P2 2 ILE A 49 ? ARG A 58 ? ILE A 49 ARG A 58 1 ? 10 HELX_P HELX_P3 3 LYS A 59 ? GLY A 62 ? LYS A 59 GLY A 62 5 ? 4 HELX_P HELX_P4 4 SER A 76 ? HIS A 88 ? SER A 76 HIS A 88 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 88 A ZN 103 1_555 ? ? ? ? ? ? ? 1.904 ? metalc2 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 32 A ZN 101 1_555 ? ? ? ? ? ? ? 1.911 ? metalc3 metalc ? ? A HIS 28 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 28 A ZN 101 1_555 ? ? ? ? ? ? ? 1.912 ? metalc4 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 83 A ZN 103 1_555 ? ? ? ? ? ? ? 1.913 ? metalc5 metalc ? ? A HIS 60 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 60 A ZN 102 1_555 ? ? ? ? ? ? ? 1.916 ? metalc6 metalc ? ? A HIS 56 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 56 A ZN 102 1_555 ? ? ? ? ? ? ? 1.917 ? metalc7 metalc ? ? A CYS 70 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 70 A ZN 103 1_555 ? ? ? ? ? ? ? 2.165 ? metalc8 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 101 1_555 ? ? ? ? ? ? ? 2.166 ? metalc9 metalc ? ? A CYS 43 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 43 A ZN 102 1_555 ? ? ? ? ? ? ? 2.167 ? metalc10 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 101 1_555 ? ? ? ? ? ? ? 2.169 ? metalc11 metalc ? ? A CYS 67 SG ? ? ? 1_555 D ZN . ZN ? ? A CYS 67 A ZN 103 1_555 ? ? ? ? ? ? ? 2.170 ? metalc12 metalc ? ? A CYS 40 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 40 A ZN 102 1_555 ? ? ? ? ? ? ? 2.170 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 10 ? THR A 11 ? PHE A 10 THR A 11 A 2 VAL A 18 ? PHE A 19 ? VAL A 18 PHE A 19 B 1 TYR A 38 ? LYS A 39 ? TYR A 38 LYS A 39 B 2 ALA A 46 ? SER A 47 ? ALA A 46 SER A 47 C 1 PHE A 65 ? ALA A 66 ? PHE A 65 ALA A 66 C 2 THR A 73 ? CYS A 74 ? THR A 73 CYS A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 10 ? N PHE A 10 O PHE A 19 ? O PHE A 19 B 1 2 N TYR A 38 ? N TYR A 38 O SER A 47 ? O SER A 47 C 1 2 N PHE A 65 ? N PHE A 65 O CYS A 74 ? O CYS A 74 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 101' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 102' AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 12 ? CYS A 12 . ? 1_555 ? 2 AC1 4 CYS A 15 ? CYS A 15 . ? 1_555 ? 3 AC1 4 HIS A 28 ? HIS A 28 . ? 1_555 ? 4 AC1 4 HIS A 32 ? HIS A 32 . ? 1_555 ? 5 AC2 4 CYS A 40 ? CYS A 40 . ? 1_555 ? 6 AC2 4 CYS A 43 ? CYS A 43 . ? 1_555 ? 7 AC2 4 HIS A 56 ? HIS A 56 . ? 1_555 ? 8 AC2 4 HIS A 60 ? HIS A 60 . ? 1_555 ? 9 AC3 4 CYS A 67 ? CYS A 67 . ? 1_555 ? 10 AC3 4 CYS A 70 ? CYS A 70 . ? 1_555 ? 11 AC3 4 HIS A 83 ? HIS A 83 . ? 1_555 ? 12 AC3 4 HIS A 88 ? HIS A 88 . ? 1_555 ? # _atom_sites.entry_id 2RV6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 HIS 60 60 60 HIS HIS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LYS 92 92 92 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 93 ZN ZN A . C 2 ZN 1 102 94 ZN ZN A . D 2 ZN 1 103 95 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 105.8 ? 2 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 109.2 ? 3 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 SG ? A CYS 70 ? A CYS 70 ? 1_555 111.2 ? 4 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 109.0 ? 5 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 110.9 ? 6 SG ? A CYS 70 ? A CYS 70 ? 1_555 ZN ? D ZN . ? A ZN 103 ? 1_555 SG ? A CYS 67 ? A CYS 67 ? 1_555 110.6 ? 7 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 NE2 ? A HIS 28 ? A HIS 28 ? 1_555 103.4 ? 8 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 15 ? A CYS 15 ? 1_555 112.4 ? 9 NE2 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 15 ? A CYS 15 ? 1_555 108.8 ? 10 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 108.7 ? 11 NE2 ? A HIS 28 ? A HIS 28 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 113.0 ? 12 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 12 ? A CYS 12 ? 1_555 110.4 ? 13 NE2 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 102.9 ? 14 NE2 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 112.6 ? 15 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 43 ? A CYS 43 ? 1_555 108.5 ? 16 NE2 ? A HIS 60 ? A HIS 60 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 109.2 ? 17 NE2 ? A HIS 56 ? A HIS 56 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 113.0 ? 18 SG ? A CYS 43 ? A CYS 43 ? 1_555 ZN ? C ZN . ? A ZN 102 ? 1_555 SG ? A CYS 40 ? A CYS 40 ? 1_555 110.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-08 2 'Structure model' 1 1 2016-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.59 ? mM '[U-13C; U-15N]' 1 TRIS-2 20 ? mM '[U-2H]' 1 'sodium chloride-3' 100 ? mM ? 1 DTT-4 1 ? mM '[U-2H]' 1 'sodium azide-5' 0.02 ? % ? 1 'zinc chloride-6' 50 ? uM ? 1 H2O-7 90 ? % ? 1 D2O-8 10 ? % '[U-2H]' 1 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 8 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 30 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 30 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 30 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.54 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.24 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 16 ? ? 59.83 15.95 2 2 THR A 33 ? ? -82.36 -87.71 3 3 ASN A 16 ? ? 59.74 14.69 4 3 SER A 44 ? ? -75.56 42.05 5 4 ASN A 34 ? ? 68.52 149.11 6 5 ASN A 16 ? ? 59.70 15.50 7 5 CYS A 43 ? ? -140.18 10.40 8 7 HIS A 60 ? ? -76.78 23.91 9 8 ASN A 16 ? ? 59.70 14.18 10 8 THR A 33 ? ? -87.26 35.63 11 8 ASN A 34 ? ? -76.50 42.57 12 9 SER A 2 ? ? 61.14 168.92 13 9 LYS A 89 ? ? -79.35 42.01 14 10 ASN A 34 ? ? -78.27 28.74 15 11 SER A 2 ? ? -80.09 40.70 16 11 ASN A 34 ? ? 63.01 159.05 17 13 ASN A 16 ? ? 59.31 14.82 18 13 LYS A 90 ? ? -83.58 43.89 19 14 ASN A 16 ? ? 59.47 15.67 20 14 GLU A 63 ? ? 63.71 163.63 21 15 SER A 5 ? ? 59.02 11.14 22 15 ASN A 16 ? ? 59.47 13.52 23 16 ASN A 16 ? ? 59.29 16.31 24 17 SER A 2 ? ? 61.95 163.36 25 18 SER A 2 ? ? 62.35 -17.80 26 18 ASN A 16 ? ? 59.28 18.36 27 18 ASN A 34 ? ? -149.48 41.77 28 19 ALA A 48 ? ? 57.73 11.59 29 20 ASN A 16 ? ? 58.15 19.32 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #