data_2RVH # _entry.id 2RVH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB150315 RCSB ? ? 2RVH PDB pdb_00002rvh 10.2210/pdb2rvh/pdb 11599 BMRB ? ? D_1000150315 WWPDB ? ? # _pdbx_database_related.db_id 11599 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RVH _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-10-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nagata, T.' 1 'Obayashi, E.' 2 'Asano, K.' 3 # _citation.id primary _citation.title 'Molecular Landscape of the Ribosome Pre-initiation Complex during mRNA Scanning: Structural Role for eIF3c and Its Control by eIF5' _citation.journal_abbrev 'Cell Rep' _citation.journal_volume 18 _citation.page_first 2651 _citation.page_last 2663 _citation.year 2017 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 2211-1247 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 28297669 _citation.pdbx_database_id_DOI 10.1016/j.celrep.2017.02.052 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Obayashi, E.' 1 ? primary 'Luna, R.E.' 2 ? primary 'Nagata, T.' 3 ? primary 'Martin-Marcos, P.' 4 ? primary 'Hiraishi, H.' 5 ? primary 'Singh, C.R.' 6 ? primary 'Erzberger, J.P.' 7 ? primary 'Zhang, F.' 8 ? primary 'Arthanari, H.' 9 ? primary 'Morris, J.' 10 ? primary 'Pellarin, R.' 11 ? primary 'Moore, C.' 12 ? primary 'Harmon, I.' 13 ? primary 'Papadopoulos, E.' 14 ? primary 'Yoshida, H.' 15 ? primary 'Nasr, M.L.' 16 ? primary 'Unzai, S.' 17 ? primary 'Thompson, B.' 18 ? primary 'Aube, E.' 19 ? primary 'Hustak, S.' 20 ? primary 'Stengel, F.' 21 ? primary 'Dagraca, E.' 22 ? primary 'Ananbandam, A.' 23 ? primary 'Gao, P.' 24 ? primary 'Urano, T.' 25 ? primary 'Hinnebusch, A.G.' 26 ? primary 'Wagner, G.' 27 ? primary 'Asano, K.' 28 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Eukaryotic translation initiation factor eIF-1' _entity.formula_weight 12330.147 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein translation factor SUI1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQL QGDQRAKVCEFMISQLGLQKKNIKIHGF ; _entity_poly.pdbx_seq_one_letter_code_can ;MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQL QGDQRAKVCEFMISQLGLQKKNIKIHGF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ILE n 1 4 GLU n 1 5 ASN n 1 6 LEU n 1 7 LYS n 1 8 SER n 1 9 PHE n 1 10 ASP n 1 11 PRO n 1 12 PHE n 1 13 ALA n 1 14 ASP n 1 15 THR n 1 16 GLY n 1 17 ASP n 1 18 ASP n 1 19 GLU n 1 20 THR n 1 21 ALA n 1 22 THR n 1 23 SER n 1 24 ASN n 1 25 TYR n 1 26 ILE n 1 27 HIS n 1 28 ILE n 1 29 ARG n 1 30 ILE n 1 31 GLN n 1 32 GLN n 1 33 ARG n 1 34 ASN n 1 35 GLY n 1 36 ARG n 1 37 LYS n 1 38 THR n 1 39 LEU n 1 40 THR n 1 41 THR n 1 42 VAL n 1 43 GLN n 1 44 GLY n 1 45 VAL n 1 46 PRO n 1 47 GLU n 1 48 GLU n 1 49 TYR n 1 50 ASP n 1 51 LEU n 1 52 LYS n 1 53 ARG n 1 54 ILE n 1 55 LEU n 1 56 LYS n 1 57 VAL n 1 58 LEU n 1 59 LYS n 1 60 LYS n 1 61 ASP n 1 62 PHE n 1 63 ALA n 1 64 CYS n 1 65 ASN n 1 66 GLY n 1 67 ASN n 1 68 ILE n 1 69 VAL n 1 70 LYS n 1 71 ASP n 1 72 PRO n 1 73 GLU n 1 74 MET n 1 75 GLY n 1 76 GLU n 1 77 ILE n 1 78 ILE n 1 79 GLN n 1 80 LEU n 1 81 GLN n 1 82 GLY n 1 83 ASP n 1 84 GLN n 1 85 ARG n 1 86 ALA n 1 87 LYS n 1 88 VAL n 1 89 CYS n 1 90 GLU n 1 91 PHE n 1 92 MET n 1 93 ILE n 1 94 SER n 1 95 GLN n 1 96 LEU n 1 97 GLY n 1 98 LEU n 1 99 GLN n 1 100 LYS n 1 101 LYS n 1 102 ASN n 1 103 ILE n 1 104 LYS n 1 105 ILE n 1 106 HIS n 1 107 GLY n 1 108 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SUI1, RFR1, YNL244C, N0905' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain S288c _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae S288c' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 559292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET28b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SUI1_YEAST _struct_ref.pdbx_db_accession P32911 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSIENLKSFDPFADTGDDETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQL QGDQRAKVCEFMISQLGLQKKNIKIHGF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RVH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32911 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HN(CA)CO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D C(CO)NH' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '2D 1H-13C HSQC' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-COSY' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 170 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.4 mM [U-100% 13C; U-100% 15N] entity-1, 20 mM sodium phosphate-2, 150 mM sodium chloride-3, 1 mM DTT-4, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2RVH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RVH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RVH _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollman' refinement Amber 1 9 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2 2.0.17 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 3 2.0.17 'Naohira Kobayashi' 'chemical shift assignment' KUJIRA 4 0.984 'Naohira Kobayashi' 'peak picking' KUJIRA 5 0.984 'Naohira Kobayashi' 'data analysis' KUJIRA 6 0.984 Johnson 'data analysis' NMRView 7 ? Johnson 'peak picking' NMRView 8 ? Johnson collection NMRView 9 ? Delaglio processing NMRDraw 10 ? Delaglio processing NMRPipe 11 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RVH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RVH _struct.title 'NMR structure of eIF1' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RVH _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'translation, translation initiation factor' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 50 ? ASP A 61 ? ASP A 50 ASP A 61 1 ? 12 HELX_P HELX_P2 2 GLN A 84 ? GLN A 95 ? GLN A 84 GLN A 95 1 ? 12 HELX_P HELX_P3 3 GLN A 99 ? LYS A 101 ? GLN A 99 LYS A 101 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 66 ? ASP A 71 ? GLY A 66 ASP A 71 A 2 GLY A 75 ? GLN A 81 ? GLY A 75 GLN A 81 A 3 THR A 38 ? GLN A 43 ? THR A 38 GLN A 43 A 4 ILE A 26 ? GLN A 32 ? ILE A 26 GLN A 32 A 5 ILE A 103 ? HIS A 106 ? ILE A 103 HIS A 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 69 ? N VAL A 69 O ILE A 77 ? O ILE A 77 A 2 3 O ILE A 78 ? O ILE A 78 N VAL A 42 ? N VAL A 42 A 3 4 O LEU A 39 ? O LEU A 39 N GLN A 31 ? N GLN A 31 A 4 5 N ILE A 26 ? N ILE A 26 O LYS A 104 ? O LYS A 104 # _atom_sites.entry_id 2RVH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-10-26 2 'Structure model' 1 1 2017-05-31 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 0.4 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 150 ? mM ? 1 DTT-4 1 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2RVH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1560 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 463 _pdbx_nmr_constraints.NOE_long_range_total_count 442 _pdbx_nmr_constraints.NOE_medium_range_total_count 261 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 394 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.52 120.30 3.22 0.50 N 2 4 NE A ARG 33 ? ? CZ A ARG 33 ? ? NH1 A ARG 33 ? ? 123.57 120.30 3.27 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 11 ? ? -89.26 -144.06 2 1 ASN A 24 ? ? 174.49 126.45 3 1 ARG A 36 ? ? 78.54 -16.91 4 2 SER A 2 ? ? 70.28 -171.57 5 2 PHE A 9 ? ? 74.09 164.52 6 2 PRO A 11 ? ? -86.14 -135.20 7 2 PHE A 12 ? ? -87.95 -141.11 8 2 ALA A 13 ? ? -73.99 -163.77 9 2 ASP A 14 ? ? -148.00 48.82 10 2 THR A 20 ? ? 72.34 -39.33 11 2 ALA A 21 ? ? -75.65 31.05 12 2 THR A 22 ? ? 76.80 -34.42 13 2 ASN A 24 ? ? -177.16 141.58 14 2 ASN A 34 ? ? -168.02 69.37 15 3 SER A 2 ? ? -160.07 -67.45 16 4 GLU A 4 ? ? -158.08 -18.56 17 4 PHE A 12 ? ? -135.36 -155.63 18 5 PHE A 12 ? ? -171.42 145.09 19 5 ASP A 17 ? ? -160.65 -153.33 20 5 SER A 23 ? ? 69.74 -11.32 21 5 HIS A 106 ? ? -126.45 -161.54 22 6 ILE A 3 ? ? 46.84 -142.97 23 6 PRO A 11 ? ? -81.96 46.86 24 7 ASN A 34 ? ? -167.95 -101.68 25 8 THR A 20 ? ? 65.37 -19.48 26 8 ASN A 34 ? ? -106.66 63.03 27 8 HIS A 106 ? ? -126.84 -157.71 28 9 GLU A 4 ? ? 76.55 -8.40 29 9 PHE A 12 ? ? 177.87 168.90 30 9 ASN A 34 ? ? -162.37 -127.72 31 10 PRO A 11 ? ? -93.66 -145.41 32 11 LEU A 6 ? ? 72.23 -52.78 33 11 GLU A 19 ? ? -149.19 -41.25 34 11 SER A 23 ? ? 88.68 134.14 35 11 GLN A 84 ? ? -75.14 25.05 36 12 PHE A 12 ? ? -162.79 3.16 37 13 THR A 20 ? ? -148.00 12.75 38 13 HIS A 106 ? ? -126.07 -159.24 39 14 ASN A 5 ? ? -150.34 30.04 40 14 PHE A 12 ? ? -176.78 142.25 41 14 THR A 22 ? ? -106.97 -100.24 42 14 ASN A 34 ? ? -168.27 -44.29 43 15 LYS A 37 ? ? -73.47 32.12 44 16 SER A 2 ? ? -75.04 35.33 45 16 THR A 20 ? ? -80.98 -71.69 46 17 THR A 20 ? ? 78.24 147.48 47 17 ASN A 24 ? ? -159.60 -47.09 48 17 ASN A 34 ? ? -149.15 -41.58 49 17 ASP A 83 ? ? -105.09 52.37 50 17 GLN A 84 ? ? -75.54 21.47 51 18 PHE A 12 ? ? 179.97 151.48 52 19 ASN A 34 ? ? -145.29 13.21 53 20 GLU A 19 ? ? 75.44 -37.08 54 20 LYS A 37 ? ? -77.35 21.39 #