data_2TGT # _entry.id 2TGT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2TGT WWPDB D_1000178676 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2TGT _pdbx_database_status.recvd_initial_deposition_date 1981-10-26 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Walter, J.' 1 'Steigemann, W.' 2 'Singh, T.P.' 3 'Bartunik, H.' 4 'Bode, W.' 5 'Huber, R.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography' 'Acta Crystallogr.,Sect.B' 38 1462 ? 1982 ASBSDK DK 0108-7681 0622 ? -1 ? 1 'The Geometry of the Reactive Site and of the Peptide Groups in Trypsin. Trypsinogen and its Complexes with Inhibitors' 'Acta Crystallogr.,Sect.B' 39 480 ? 1983 ASBSDK DK 0108-7681 0622 ? ? ? 2 ;Low-Temperature Protein Crystallography. Effect on Flexibility, Temperature Factor, Mosaic Spread, Extinction, and Diffuse Scattering in Two Examples. Bovine Trypsinogen and Fc Fragment ; 'Acta Crystallogr.,Sect.B' 36 621 ? 1980 ASBSDK DK 0108-7681 0622 ? ? ? 3 'Structural Basis of the Activation and Action of Trypsin' Acc.Chem.Res. 11 114 ? 1978 ACHRE4 US 0001-4842 0411 ? ? ? 4 'Crystal Structure Analysis and Refinement of Two Variants of Trigonal Trypsinogen' 'FEBS Lett.' 90 265 ? 1978 FEBLAL NE 0014-5793 0165 ? ? ? 5 ;Crystal Structure of Bovine Trypsinogen at 1.8 Angstroms Resolution. II. Crystallographic Refinement, Refined Crystal Structure and Comparison with Bovine Trypsin ; J.Mol.Biol. 111 415 ? 1977 JMOBAK UK 0022-2836 0070 ? ? ? 6 ;Crystal Structure of Bovine Trypsinogen at 1.8 Angstroms Resolution. I. Data Collection, Application of Patterson Search Techniques and Preliminary Structural Interpretation ; J.Mol.Biol. 106 325 ? 1976 JMOBAK UK 0022-2836 0070 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Walter, J.' 1 primary 'Steigemann, W.' 2 primary 'Singh, T.P.' 3 primary 'Bartunik, H.' 4 primary 'Bode, W.' 5 primary 'Huber, R.' 6 1 'Marquart, M.' 7 1 'Walter, J.' 8 1 'Deisenhofer, J.' 9 1 'Bode, W.' 10 1 'Huber, R.' 11 2 'Singh, T.P.' 12 2 'Bode, W.' 13 2 'Huber, R.' 14 3 'Huber, R.' 15 3 'Bode, W.' 16 4 'Bode, W.' 17 4 'Huber, R.' 18 5 'Fehlhammer, H.' 19 5 'Bode, W.' 20 5 'Huber, R.' 21 6 'Bode, W.' 22 6 'Fehlhammer, H.' 23 6 'Huber, R.' 24 # _cell.entry_id 2TGT _cell.length_a 55.500 _cell.length_b 55.500 _cell.length_c 107.800 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2TGT _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man TRYPSINOGEN 24012.953 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn METHANOL 32.042 2 ? ? ? ? 4 water nat water 18.015 137 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHP SYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;VDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHP SYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPG QITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ASP n 1 3 ASP n 1 4 ASP n 1 5 ASP n 1 6 LYS n 1 7 ILE n 1 8 VAL n 1 9 GLY n 1 10 GLY n 1 11 TYR n 1 12 THR n 1 13 CYS n 1 14 GLY n 1 15 ALA n 1 16 ASN n 1 17 THR n 1 18 VAL n 1 19 PRO n 1 20 TYR n 1 21 GLN n 1 22 VAL n 1 23 SER n 1 24 LEU n 1 25 ASN n 1 26 SER n 1 27 GLY n 1 28 TYR n 1 29 HIS n 1 30 PHE n 1 31 CYS n 1 32 GLY n 1 33 GLY n 1 34 SER n 1 35 LEU n 1 36 ILE n 1 37 ASN n 1 38 SER n 1 39 GLN n 1 40 TRP n 1 41 VAL n 1 42 VAL n 1 43 SER n 1 44 ALA n 1 45 ALA n 1 46 HIS n 1 47 CYS n 1 48 TYR n 1 49 LYS n 1 50 SER n 1 51 GLY n 1 52 ILE n 1 53 GLN n 1 54 VAL n 1 55 ARG n 1 56 LEU n 1 57 GLY n 1 58 GLU n 1 59 ASP n 1 60 ASN n 1 61 ILE n 1 62 ASN n 1 63 VAL n 1 64 VAL n 1 65 GLU n 1 66 GLY n 1 67 ASN n 1 68 GLU n 1 69 GLN n 1 70 PHE n 1 71 ILE n 1 72 SER n 1 73 ALA n 1 74 SER n 1 75 LYS n 1 76 SER n 1 77 ILE n 1 78 VAL n 1 79 HIS n 1 80 PRO n 1 81 SER n 1 82 TYR n 1 83 ASN n 1 84 SER n 1 85 ASN n 1 86 THR n 1 87 LEU n 1 88 ASN n 1 89 ASN n 1 90 ASP n 1 91 ILE n 1 92 MET n 1 93 LEU n 1 94 ILE n 1 95 LYS n 1 96 LEU n 1 97 LYS n 1 98 SER n 1 99 ALA n 1 100 ALA n 1 101 SER n 1 102 LEU n 1 103 ASN n 1 104 SER n 1 105 ARG n 1 106 VAL n 1 107 ALA n 1 108 SER n 1 109 ILE n 1 110 SER n 1 111 LEU n 1 112 PRO n 1 113 THR n 1 114 SER n 1 115 CYS n 1 116 ALA n 1 117 SER n 1 118 ALA n 1 119 GLY n 1 120 THR n 1 121 GLN n 1 122 CYS n 1 123 LEU n 1 124 ILE n 1 125 SER n 1 126 GLY n 1 127 TRP n 1 128 GLY n 1 129 ASN n 1 130 THR n 1 131 LYS n 1 132 SER n 1 133 SER n 1 134 GLY n 1 135 THR n 1 136 SER n 1 137 TYR n 1 138 PRO n 1 139 ASP n 1 140 VAL n 1 141 LEU n 1 142 LYS n 1 143 CYS n 1 144 LEU n 1 145 LYS n 1 146 ALA n 1 147 PRO n 1 148 ILE n 1 149 LEU n 1 150 SER n 1 151 ASP n 1 152 SER n 1 153 SER n 1 154 CYS n 1 155 LYS n 1 156 SER n 1 157 ALA n 1 158 TYR n 1 159 PRO n 1 160 GLY n 1 161 GLN n 1 162 ILE n 1 163 THR n 1 164 SER n 1 165 ASN n 1 166 MET n 1 167 PHE n 1 168 CYS n 1 169 ALA n 1 170 GLY n 1 171 TYR n 1 172 LEU n 1 173 GLU n 1 174 GLY n 1 175 GLY n 1 176 LYS n 1 177 ASP n 1 178 SER n 1 179 CYS n 1 180 GLN n 1 181 GLY n 1 182 ASP n 1 183 SER n 1 184 GLY n 1 185 GLY n 1 186 PRO n 1 187 VAL n 1 188 VAL n 1 189 CYS n 1 190 SER n 1 191 GLY n 1 192 LYS n 1 193 LEU n 1 194 GLN n 1 195 GLY n 1 196 ILE n 1 197 VAL n 1 198 SER n 1 199 TRP n 1 200 GLY n 1 201 SER n 1 202 GLY n 1 203 CYS n 1 204 ALA n 1 205 GLN n 1 206 LYS n 1 207 ASN n 1 208 LYS n 1 209 PRO n 1 210 GLY n 1 211 VAL n 1 212 TYR n 1 213 THR n 1 214 LYS n 1 215 VAL n 1 216 CYS n 1 217 ASN n 1 218 TYR n 1 219 VAL n 1 220 SER n 1 221 TRP n 1 222 ILE n 1 223 LYS n 1 224 GLN n 1 225 THR n 1 226 ILE n 1 227 ALA n 1 228 SER n 1 229 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name bovine _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue PANCREAS _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00760 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKA PILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTI ASN ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2TGT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 229 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00760 _struct_ref_seq.db_align_beg 15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 243 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 245 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MOH non-polymer . METHANOL ? 'C H4 O' 32.042 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2TGT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.00 _exptl_crystal.density_percent_sol 38.35 _exptl_crystal.description ? # _refine.entry_id 2TGT _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 6.5 _refine.ls_d_res_high 1.7 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.209 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ;THERE ARE FOUR *FLEXIBLE* SEGMENTS FOR WHICH THERE IS NO SIGNIFICANT ELECTRON DENSITY IN THE MAP. THESE ARE 1. THREE CLOSELY INTERDIGITATING CHAIN SEGMENTS FORMING THE ACTIVATION DOMAIN GLY 142 - PRO 152 GLY 184A - GLY 193 GLY 216 - ASN 223 2. THE N-TERMINUS FROM VAL 10 THROUGH GLY 18 (THIS DATA ENTRY CONTAINS NO COORDINATES FOR VAL 10 THROUGH LYS 15) ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1629 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 141 _refine_hist.number_atoms_total 1771 _refine_hist.d_res_high 1.7 _refine_hist.d_res_low 6.5 # _struct.entry_id 2TGT _struct.title 'ON THE DISORDERED ACTIVATION DOMAIN IN TRYPSINOGEN. CHEMICAL LABELLING AND LOW-TEMPERATURE CRYSTALLOGRAPHY' _struct.pdbx_descriptor 'TRYPSINOGEN (103 DEGREES K, 0.70 METHANOL, 0.30 WATER)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2TGT _struct_keywords.pdbx_keywords 'HYDROLASE ZYMOGEN (SERINE PROTEINASE)' _struct_keywords.text 'HYDROLASE ZYMOGEN (SERINE PROTEINASE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 H1 SER A 150 ? ILE A 162 ? SER A 164 ILE A 176 1 'SNGL ALPHA TURN,REST IRREG.' 13 HELX_P HELX_P2 H2 LYS A 214 ? VAL A 219 ? LYS A 230 VAL A 235 5 'CONTIGUOUS WITH H3' 6 HELX_P HELX_P3 H3 SER A 220 ? ASN A 229 ? SER A 236 ASN A 245 1 'CONTIGUOUS WITH H2' 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 143 SG ? ? A CYS 22 A CYS 157 1_555 ? ? ? ? ? ? ? 2.048 ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 42 A CYS 58 1_555 ? ? ? ? ? ? ? 2.050 ? disulf3 disulf ? ? A CYS 115 SG ? ? ? 1_555 A CYS 216 SG ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.078 ? disulf4 disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.048 ? disulf5 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 168 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.060 ? disulf6 disulf ? ? A CYS 179 SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.057 ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 58 OE1 ? ? A CA 480 A GLU 70 1_555 ? ? ? ? ? ? ? 2.158 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A GLU 68 OE2 ? ? A CA 480 A GLU 80 1_555 ? ? ? ? ? ? ? 2.267 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 480 A HOH 711 1_555 ? ? ? ? ? ? ? 2.559 ? metalc4 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 480 A HOH 714 1_555 ? ? ? ? ? ? ? 2.313 ? metalc5 metalc ? ? B CA . CA ? ? ? 1_555 A ASN 60 O ? ? A CA 480 A ASN 72 1_555 ? ? ? ? ? ? ? 2.285 ? metalc6 metalc ? ? B CA . CA ? ? ? 1_555 A VAL 63 O ? ? A CA 480 A VAL 75 1_555 ? ? ? ? ? ? ? 2.266 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? THR A 12 ? TYR A 20 THR A 21 A 2 LYS A 142 ? PRO A 147 ? LYS A 156 PRO A 161 A 3 GLN A 121 ? GLY A 126 ? GLN A 135 GLY A 140 A 4 PRO A 186 ? CYS A 189 ? PRO A 198 CYS A 201 A 5 LYS A 192 ? TRP A 199 ? LYS A 204 TRP A 215 A 6 GLY A 210 ? LYS A 214 ? GLY A 226 LYS A 230 A 7 MET A 166 ? ALA A 169 ? MET A 180 ALA A 183 B 1 GLN A 21 ? ASN A 25 ? GLN A 30 ASN A 34 B 2 HIS A 29 ? ASN A 37 ? HIS A 40 ASN A 48 B 3 TRP A 40 ? SER A 43 ? TRP A 51 SER A 54 B 4 MET A 92 ? LEU A 96 ? MET A 104 LEU A 108 B 5 GLN A 69 ? VAL A 78 ? GLN A 81 VAL A 90 B 6 GLN A 53 ? LEU A 56 ? GLN A 64 LEU A 67 B 7 GLN A 21 ? ASN A 25 ? GLN A 30 ASN A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 11 ? O TYR A 20 N CYS A 143 ? N CYS A 157 A 2 3 O ALA A 146 ? O ALA A 160 N CYS A 122 ? N CYS A 136 A 3 4 N SER A 125 ? N SER A 139 O PRO A 186 ? O PRO A 198 A 4 5 N CYS A 189 ? N CYS A 201 O LYS A 192 ? O LYS A 204 A 5 6 O TRP A 199 ? O TRP A 215 N VAL A 211 ? N VAL A 227 A 6 7 N TYR A 212 ? N TYR A 228 O PHE A 167 ? O PHE A 181 B 1 2 O LEU A 24 ? O LEU A 33 N PHE A 30 ? N PHE A 41 B 2 3 N ILE A 36 ? N ILE A 47 O TRP A 40 ? O TRP A 51 B 3 4 N SER A 43 ? N SER A 54 O MET A 92 ? O MET A 104 B 4 5 O LYS A 95 ? O LYS A 107 N SER A 74 ? N SER A 86 B 5 6 O ILE A 71 ? O ILE A 83 N VAL A 54 ? N VAL A 65 B 6 7 N ARG A 55 ? N ARG A 66 O SER A 23 ? O SER A 32 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 480' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MOH A 900' AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MOH A 901' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 58 ? GLU A 70 . ? 1_555 ? 2 AC1 6 ASN A 60 ? ASN A 72 . ? 1_555 ? 3 AC1 6 VAL A 63 ? VAL A 75 . ? 1_555 ? 4 AC1 6 GLU A 68 ? GLU A 80 . ? 1_555 ? 5 AC1 6 HOH E . ? HOH A 711 . ? 1_555 ? 6 AC1 6 HOH E . ? HOH A 714 . ? 1_555 ? 7 AC2 4 TYR A 48 ? TYR A 59 . ? 1_555 ? 8 AC2 4 ASN A 62 ? ASN A 74 . ? 5_565 ? 9 AC2 4 TYR A 82 ? TYR A 94 . ? 1_555 ? 10 AC2 4 HOH E . ? HOH A 719 . ? 1_555 ? 11 AC3 7 GLY A 33 ? GLY A 44 . ? 1_555 ? 12 AC3 7 SER A 34 ? SER A 45 . ? 1_555 ? 13 AC3 7 VAL A 42 ? VAL A 53 . ? 1_555 ? 14 AC3 7 GLY A 184 ? GLY A 196 . ? 1_555 ? 15 AC3 7 GLY A 185 ? GLY A 197 . ? 1_555 ? 16 AC3 7 PRO A 186 ? PRO A 198 . ? 1_555 ? 17 AC3 7 ILE A 196 ? ILE A 212 . ? 1_555 ? # _database_PDB_matrix.entry_id 2TGT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] .577350 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.154701 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2TGT _atom_sites.fract_transf_matrix[1][1] .018018 _atom_sites.fract_transf_matrix[1][2] .010403 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] .020805 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] .009276 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'SEE REMARKS 4 AND 6.' # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 10 ? ? ? A . n A 1 2 ASP 2 11 ? ? ? A . n A 1 3 ASP 3 12 ? ? ? A . n A 1 4 ASP 4 13 ? ? ? A . n A 1 5 ASP 5 14 ? ? ? A . n A 1 6 LYS 6 15 ? ? ? A . n A 1 7 ILE 7 16 16 ILE ILE A . n A 1 8 VAL 8 17 17 VAL VAL A . n A 1 9 GLY 9 18 18 GLY GLY A . n A 1 10 GLY 10 19 19 GLY GLY A . n A 1 11 TYR 11 20 20 TYR TYR A . n A 1 12 THR 12 21 21 THR THR A . n A 1 13 CYS 13 22 22 CYS CYS A . n A 1 14 GLY 14 23 23 GLY GLY A . n A 1 15 ALA 15 24 24 ALA ALA A . n A 1 16 ASN 16 25 25 ASN ASN A . n A 1 17 THR 17 26 26 THR THR A . n A 1 18 VAL 18 27 27 VAL VAL A . n A 1 19 PRO 19 28 28 PRO PRO A . n A 1 20 TYR 20 29 29 TYR TYR A . n A 1 21 GLN 21 30 30 GLN GLN A . n A 1 22 VAL 22 31 31 VAL VAL A . n A 1 23 SER 23 32 32 SER SER A . n A 1 24 LEU 24 33 33 LEU LEU A . n A 1 25 ASN 25 34 34 ASN ASN A . n A 1 26 SER 26 37 37 SER SER A . n A 1 27 GLY 27 38 38 GLY GLY A . n A 1 28 TYR 28 39 39 TYR TYR A . n A 1 29 HIS 29 40 40 HIS HIS A . n A 1 30 PHE 30 41 41 PHE PHE A . n A 1 31 CYS 31 42 42 CYS CYS A . n A 1 32 GLY 32 43 43 GLY GLY A . n A 1 33 GLY 33 44 44 GLY GLY A . n A 1 34 SER 34 45 45 SER SER A . n A 1 35 LEU 35 46 46 LEU LEU A . n A 1 36 ILE 36 47 47 ILE ILE A . n A 1 37 ASN 37 48 48 ASN ASN A . n A 1 38 SER 38 49 49 SER SER A . n A 1 39 GLN 39 50 50 GLN GLN A . n A 1 40 TRP 40 51 51 TRP TRP A . n A 1 41 VAL 41 52 52 VAL VAL A . n A 1 42 VAL 42 53 53 VAL VAL A . n A 1 43 SER 43 54 54 SER SER A . n A 1 44 ALA 44 55 55 ALA ALA A . n A 1 45 ALA 45 56 56 ALA ALA A . n A 1 46 HIS 46 57 57 HIS HIS A . n A 1 47 CYS 47 58 58 CYS CYS A . n A 1 48 TYR 48 59 59 TYR TYR A . n A 1 49 LYS 49 60 60 LYS LYS A . n A 1 50 SER 50 61 61 SER SER A . n A 1 51 GLY 51 62 62 GLY GLY A . n A 1 52 ILE 52 63 63 ILE ILE A . n A 1 53 GLN 53 64 64 GLN GLN A . n A 1 54 VAL 54 65 65 VAL VAL A . n A 1 55 ARG 55 66 66 ARG ARG A . n A 1 56 LEU 56 67 67 LEU LEU A . n A 1 57 GLY 57 69 69 GLY GLY A . n A 1 58 GLU 58 70 70 GLU GLU A . n A 1 59 ASP 59 71 71 ASP ASP A . n A 1 60 ASN 60 72 72 ASN ASN A . n A 1 61 ILE 61 73 73 ILE ILE A . n A 1 62 ASN 62 74 74 ASN ASN A . n A 1 63 VAL 63 75 75 VAL VAL A . n A 1 64 VAL 64 76 76 VAL VAL A . n A 1 65 GLU 65 77 77 GLU GLU A . n A 1 66 GLY 66 78 78 GLY GLY A . n A 1 67 ASN 67 79 79 ASN ASN A . n A 1 68 GLU 68 80 80 GLU GLU A . n A 1 69 GLN 69 81 81 GLN GLN A . n A 1 70 PHE 70 82 82 PHE PHE A . n A 1 71 ILE 71 83 83 ILE ILE A . n A 1 72 SER 72 84 84 SER SER A . n A 1 73 ALA 73 85 85 ALA ALA A . n A 1 74 SER 74 86 86 SER SER A . n A 1 75 LYS 75 87 87 LYS LYS A . n A 1 76 SER 76 88 88 SER SER A . n A 1 77 ILE 77 89 89 ILE ILE A . n A 1 78 VAL 78 90 90 VAL VAL A . n A 1 79 HIS 79 91 91 HIS HIS A . n A 1 80 PRO 80 92 92 PRO PRO A . n A 1 81 SER 81 93 93 SER SER A . n A 1 82 TYR 82 94 94 TYR TYR A . n A 1 83 ASN 83 95 95 ASN ASN A . n A 1 84 SER 84 96 96 SER SER A . n A 1 85 ASN 85 97 97 ASN ASN A . n A 1 86 THR 86 98 98 THR THR A . n A 1 87 LEU 87 99 99 LEU LEU A . n A 1 88 ASN 88 100 100 ASN ASN A . n A 1 89 ASN 89 101 101 ASN ASN A . n A 1 90 ASP 90 102 102 ASP ASP A . n A 1 91 ILE 91 103 103 ILE ILE A . n A 1 92 MET 92 104 104 MET MET A . n A 1 93 LEU 93 105 105 LEU LEU A . n A 1 94 ILE 94 106 106 ILE ILE A . n A 1 95 LYS 95 107 107 LYS LYS A . n A 1 96 LEU 96 108 108 LEU LEU A . n A 1 97 LYS 97 109 109 LYS LYS A . n A 1 98 SER 98 110 110 SER SER A . n A 1 99 ALA 99 111 111 ALA ALA A . n A 1 100 ALA 100 112 112 ALA ALA A . n A 1 101 SER 101 113 113 SER SER A . n A 1 102 LEU 102 114 114 LEU LEU A . n A 1 103 ASN 103 115 115 ASN ASN A . n A 1 104 SER 104 116 116 SER SER A . n A 1 105 ARG 105 117 117 ARG ARG A . n A 1 106 VAL 106 118 118 VAL VAL A . n A 1 107 ALA 107 119 119 ALA ALA A . n A 1 108 SER 108 120 120 SER SER A . n A 1 109 ILE 109 121 121 ILE ILE A . n A 1 110 SER 110 122 122 SER SER A . n A 1 111 LEU 111 123 123 LEU LEU A . n A 1 112 PRO 112 124 124 PRO PRO A . n A 1 113 THR 113 125 125 THR THR A . n A 1 114 SER 114 127 127 SER SER A . n A 1 115 CYS 115 128 128 CYS CYS A . n A 1 116 ALA 116 129 129 ALA ALA A . n A 1 117 SER 117 130 130 SER SER A . n A 1 118 ALA 118 132 132 ALA ALA A . n A 1 119 GLY 119 133 133 GLY GLY A . n A 1 120 THR 120 134 134 THR THR A . n A 1 121 GLN 121 135 135 GLN GLN A . n A 1 122 CYS 122 136 136 CYS CYS A . n A 1 123 LEU 123 137 137 LEU LEU A . n A 1 124 ILE 124 138 138 ILE ILE A . n A 1 125 SER 125 139 139 SER SER A . n A 1 126 GLY 126 140 140 GLY GLY A . n A 1 127 TRP 127 141 141 TRP TRP A . n A 1 128 GLY 128 142 142 GLY GLY A . n A 1 129 ASN 129 143 143 ASN ASN A . n A 1 130 THR 130 144 144 THR THR A . n A 1 131 LYS 131 145 145 LYS LYS A . n A 1 132 SER 132 146 146 SER SER A . n A 1 133 SER 133 147 147 SER SER A . n A 1 134 GLY 134 148 148 GLY GLY A . n A 1 135 THR 135 149 149 THR THR A . n A 1 136 SER 136 150 150 SER SER A . n A 1 137 TYR 137 151 151 TYR TYR A . n A 1 138 PRO 138 152 152 PRO PRO A . n A 1 139 ASP 139 153 153 ASP ASP A . n A 1 140 VAL 140 154 154 VAL VAL A . n A 1 141 LEU 141 155 155 LEU LEU A . n A 1 142 LYS 142 156 156 LYS LYS A . n A 1 143 CYS 143 157 157 CYS CYS A . n A 1 144 LEU 144 158 158 LEU LEU A . n A 1 145 LYS 145 159 159 LYS LYS A . n A 1 146 ALA 146 160 160 ALA ALA A . n A 1 147 PRO 147 161 161 PRO PRO A . n A 1 148 ILE 148 162 162 ILE ILE A . n A 1 149 LEU 149 163 163 LEU LEU A . n A 1 150 SER 150 164 164 SER SER A . n A 1 151 ASP 151 165 165 ASP ASP A . n A 1 152 SER 152 166 166 SER SER A . n A 1 153 SER 153 167 167 SER SER A . n A 1 154 CYS 154 168 168 CYS CYS A . n A 1 155 LYS 155 169 169 LYS LYS A . n A 1 156 SER 156 170 170 SER SER A . n A 1 157 ALA 157 171 171 ALA ALA A . n A 1 158 TYR 158 172 172 TYR TYR A . n A 1 159 PRO 159 173 173 PRO PRO A . n A 1 160 GLY 160 174 174 GLY GLY A . n A 1 161 GLN 161 175 175 GLN GLN A . n A 1 162 ILE 162 176 176 ILE ILE A . n A 1 163 THR 163 177 177 THR THR A . n A 1 164 SER 164 178 178 SER SER A . n A 1 165 ASN 165 179 179 ASN ASN A . n A 1 166 MET 166 180 180 MET MET A . n A 1 167 PHE 167 181 181 PHE PHE A . n A 1 168 CYS 168 182 182 CYS CYS A . n A 1 169 ALA 169 183 183 ALA ALA A . n A 1 170 GLY 170 184 184 GLY GLY A A n A 1 171 TYR 171 184 184 TYR TYR A . n A 1 172 LEU 172 185 185 LEU LEU A . n A 1 173 GLU 173 186 186 GLU GLU A . n A 1 174 GLY 174 187 187 GLY GLY A . n A 1 175 GLY 175 188 188 GLY GLY A A n A 1 176 LYS 176 188 188 LYS LYS A . n A 1 177 ASP 177 189 189 ASP ASP A . n A 1 178 SER 178 190 190 SER SER A . n A 1 179 CYS 179 191 191 CYS CYS A . n A 1 180 GLN 180 192 192 GLN GLN A . n A 1 181 GLY 181 193 193 GLY GLY A . n A 1 182 ASP 182 194 194 ASP ASP A . n A 1 183 SER 183 195 195 SER SER A . n A 1 184 GLY 184 196 196 GLY GLY A . n A 1 185 GLY 185 197 197 GLY GLY A . n A 1 186 PRO 186 198 198 PRO PRO A . n A 1 187 VAL 187 199 199 VAL VAL A . n A 1 188 VAL 188 200 200 VAL VAL A . n A 1 189 CYS 189 201 201 CYS CYS A . n A 1 190 SER 190 202 202 SER SER A . n A 1 191 GLY 191 203 203 GLY GLY A . n A 1 192 LYS 192 204 204 LYS LYS A . n A 1 193 LEU 193 209 209 LEU LEU A . n A 1 194 GLN 194 210 210 GLN GLN A . n A 1 195 GLY 195 211 211 GLY GLY A . n A 1 196 ILE 196 212 212 ILE ILE A . n A 1 197 VAL 197 213 213 VAL VAL A . n A 1 198 SER 198 214 214 SER SER A . n A 1 199 TRP 199 215 215 TRP TRP A . n A 1 200 GLY 200 216 216 GLY GLY A . n A 1 201 SER 201 217 217 SER SER A . n A 1 202 GLY 202 219 219 GLY GLY A . n A 1 203 CYS 203 220 220 CYS CYS A . n A 1 204 ALA 204 221 221 ALA ALA A A n A 1 205 GLN 205 221 221 GLN GLN A . n A 1 206 LYS 206 222 222 LYS LYS A . n A 1 207 ASN 207 223 223 ASN ASN A . n A 1 208 LYS 208 224 224 LYS LYS A . n A 1 209 PRO 209 225 225 PRO PRO A . n A 1 210 GLY 210 226 226 GLY GLY A . n A 1 211 VAL 211 227 227 VAL VAL A . n A 1 212 TYR 212 228 228 TYR TYR A . n A 1 213 THR 213 229 229 THR THR A . n A 1 214 LYS 214 230 230 LYS LYS A . n A 1 215 VAL 215 231 231 VAL VAL A . n A 1 216 CYS 216 232 232 CYS CYS A . n A 1 217 ASN 217 233 233 ASN ASN A . n A 1 218 TYR 218 234 234 TYR TYR A . n A 1 219 VAL 219 235 235 VAL VAL A . n A 1 220 SER 220 236 236 SER SER A . n A 1 221 TRP 221 237 237 TRP TRP A . n A 1 222 ILE 222 238 238 ILE ILE A . n A 1 223 LYS 223 239 239 LYS LYS A . n A 1 224 GLN 224 240 240 GLN GLN A . n A 1 225 THR 225 241 241 THR THR A . n A 1 226 ILE 226 242 242 ILE ILE A . n A 1 227 ALA 227 243 243 ALA ALA A . n A 1 228 SER 228 244 244 SER SER A . n A 1 229 ASN 229 245 245 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 480 480 CA CA A . C 3 MOH 1 900 900 MOH MOH A . D 3 MOH 1 901 901 MOH MOH A . E 4 HOH 1 406 406 HOH HOH A . E 4 HOH 2 408 408 HOH HOH A . E 4 HOH 3 412 412 HOH HOH A . E 4 HOH 4 416 416 HOH HOH A . E 4 HOH 5 439 439 HOH HOH A . E 4 HOH 6 457 457 HOH HOH A . E 4 HOH 7 470 470 HOH HOH A . E 4 HOH 8 473 473 HOH HOH A . E 4 HOH 9 516 516 HOH HOH A . E 4 HOH 10 530 530 HOH HOH A . E 4 HOH 11 604 604 HOH HOH A . E 4 HOH 12 700 700 HOH HOH A . E 4 HOH 13 701 701 HOH HOH A . E 4 HOH 14 703 703 HOH HOH A . E 4 HOH 15 706 706 HOH HOH A . E 4 HOH 16 707 707 HOH HOH A . E 4 HOH 17 708 708 HOH HOH A . E 4 HOH 18 709 709 HOH HOH A . E 4 HOH 19 710 710 HOH HOH A . E 4 HOH 20 711 711 HOH HOH A . E 4 HOH 21 712 712 HOH HOH A . E 4 HOH 22 713 713 HOH HOH A . E 4 HOH 23 714 714 HOH HOH A . E 4 HOH 24 715 715 HOH HOH A . E 4 HOH 25 716 716 HOH HOH A . E 4 HOH 26 717 717 HOH HOH A . E 4 HOH 27 718 718 HOH HOH A . E 4 HOH 28 719 719 HOH HOH A . E 4 HOH 29 720 720 HOH HOH A . E 4 HOH 30 721 721 HOH HOH A . E 4 HOH 31 722 722 HOH HOH A . E 4 HOH 32 723 723 HOH HOH A . E 4 HOH 33 725 725 HOH HOH A . E 4 HOH 34 726 726 HOH HOH A . E 4 HOH 35 727 727 HOH HOH A . E 4 HOH 36 729 729 HOH HOH A . E 4 HOH 37 733 733 HOH HOH A . E 4 HOH 38 735 735 HOH HOH A . E 4 HOH 39 737 737 HOH HOH A . E 4 HOH 40 738 738 HOH HOH A . E 4 HOH 41 740 740 HOH HOH A . E 4 HOH 42 741 741 HOH HOH A . E 4 HOH 43 742 742 HOH HOH A . E 4 HOH 44 743 743 HOH HOH A . E 4 HOH 45 744 744 HOH HOH A . E 4 HOH 46 747 747 HOH HOH A . E 4 HOH 47 748 748 HOH HOH A . E 4 HOH 48 750 750 HOH HOH A . E 4 HOH 49 751 751 HOH HOH A . E 4 HOH 50 752 752 HOH HOH A . E 4 HOH 51 753 753 HOH HOH A . E 4 HOH 52 754 754 HOH HOH A . E 4 HOH 53 755 755 HOH HOH A . E 4 HOH 54 801 801 HOH HOH A . E 4 HOH 55 802 802 HOH HOH A . E 4 HOH 56 804 804 HOH HOH A . E 4 HOH 57 805 805 HOH HOH A . E 4 HOH 58 807 807 HOH HOH A . E 4 HOH 59 808 808 HOH HOH A . E 4 HOH 60 809 809 HOH HOH A . E 4 HOH 61 810 810 HOH HOH A . E 4 HOH 62 811 811 HOH HOH A . E 4 HOH 63 812 812 HOH HOH A . E 4 HOH 64 816 816 HOH HOH A . E 4 HOH 65 817 817 HOH HOH A . E 4 HOH 66 818 818 HOH HOH A . E 4 HOH 67 819 819 HOH HOH A . E 4 HOH 68 820 820 HOH HOH A . E 4 HOH 69 821 821 HOH HOH A . E 4 HOH 70 823 823 HOH HOH A . E 4 HOH 71 824 824 HOH HOH A . E 4 HOH 72 825 825 HOH HOH A . E 4 HOH 73 826 826 HOH HOH A . E 4 HOH 74 827 827 HOH HOH A . E 4 HOH 75 828 828 HOH HOH A . E 4 HOH 76 829 829 HOH HOH A . E 4 HOH 77 831 831 HOH HOH A . E 4 HOH 78 832 832 HOH HOH A . E 4 HOH 79 833 833 HOH HOH A . E 4 HOH 80 834 834 HOH HOH A . E 4 HOH 81 835 835 HOH HOH A . E 4 HOH 82 836 836 HOH HOH A . E 4 HOH 83 840 840 HOH HOH A . E 4 HOH 84 841 841 HOH HOH A . E 4 HOH 85 842 842 HOH HOH A . E 4 HOH 86 843 843 HOH HOH A . E 4 HOH 87 844 844 HOH HOH A . E 4 HOH 88 845 845 HOH HOH A . E 4 HOH 89 846 846 HOH HOH A . E 4 HOH 90 847 847 HOH HOH A . E 4 HOH 91 849 849 HOH HOH A . E 4 HOH 92 852 852 HOH HOH A . E 4 HOH 93 853 853 HOH HOH A . E 4 HOH 94 855 855 HOH HOH A . E 4 HOH 95 856 856 HOH HOH A . E 4 HOH 96 857 857 HOH HOH A . E 4 HOH 97 858 858 HOH HOH A . E 4 HOH 98 859 859 HOH HOH A . E 4 HOH 99 860 860 HOH HOH A . E 4 HOH 100 861 861 HOH HOH A . E 4 HOH 101 862 862 HOH HOH A . E 4 HOH 102 863 863 HOH HOH A . E 4 HOH 103 864 864 HOH HOH A . E 4 HOH 104 865 865 HOH HOH A . E 4 HOH 105 866 866 HOH HOH A . E 4 HOH 106 867 867 HOH HOH A . E 4 HOH 107 868 868 HOH HOH A . E 4 HOH 108 869 869 HOH HOH A . E 4 HOH 109 870 870 HOH HOH A . E 4 HOH 110 871 871 HOH HOH A . E 4 HOH 111 872 872 HOH HOH A . E 4 HOH 112 873 873 HOH HOH A . E 4 HOH 113 874 874 HOH HOH A . E 4 HOH 114 875 875 HOH HOH A . E 4 HOH 115 876 876 HOH HOH A . E 4 HOH 116 877 877 HOH HOH A . E 4 HOH 117 878 878 HOH HOH A . E 4 HOH 118 879 879 HOH HOH A . E 4 HOH 119 880 880 HOH HOH A . E 4 HOH 120 881 881 HOH HOH A . E 4 HOH 121 882 882 HOH HOH A . E 4 HOH 122 883 883 HOH HOH A . E 4 HOH 123 884 884 HOH HOH A . E 4 HOH 124 885 885 HOH HOH A . E 4 HOH 125 886 886 HOH HOH A . E 4 HOH 126 887 887 HOH HOH A . E 4 HOH 127 888 888 HOH HOH A . E 4 HOH 128 889 889 HOH HOH A . E 4 HOH 129 890 890 HOH HOH A . E 4 HOH 130 892 892 HOH HOH A . E 4 HOH 131 893 893 HOH HOH A . E 4 HOH 132 894 894 HOH HOH A . E 4 HOH 133 895 895 HOH HOH A . E 4 HOH 134 896 896 HOH HOH A . E 4 HOH 135 897 897 HOH HOH A . E 4 HOH 136 898 898 HOH HOH A . E 4 HOH 137 899 899 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 58 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 OE2 ? A GLU 68 ? A GLU 80 ? 1_555 106.1 ? 2 OE1 ? A GLU 58 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? E HOH . ? A HOH 711 ? 1_555 82.2 ? 3 OE2 ? A GLU 68 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? E HOH . ? A HOH 711 ? 1_555 92.3 ? 4 OE1 ? A GLU 58 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? E HOH . ? A HOH 714 ? 1_555 83.7 ? 5 OE2 ? A GLU 68 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? E HOH . ? A HOH 714 ? 1_555 79.1 ? 6 O ? E HOH . ? A HOH 711 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? E HOH . ? A HOH 714 ? 1_555 160.7 ? 7 OE1 ? A GLU 58 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A ASN 60 ? A ASN 72 ? 1_555 89.8 ? 8 OE2 ? A GLU 68 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A ASN 60 ? A ASN 72 ? 1_555 158.8 ? 9 O ? E HOH . ? A HOH 711 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A ASN 60 ? A ASN 72 ? 1_555 103.9 ? 10 O ? E HOH . ? A HOH 714 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A ASN 60 ? A ASN 72 ? 1_555 89.1 ? 11 OE1 ? A GLU 58 ? A GLU 70 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 63 ? A VAL 75 ? 1_555 164.4 ? 12 OE2 ? A GLU 68 ? A GLU 80 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 63 ? A VAL 75 ? 1_555 87.6 ? 13 O ? E HOH . ? A HOH 711 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 63 ? A VAL 75 ? 1_555 89.9 ? 14 O ? E HOH . ? A HOH 714 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 63 ? A VAL 75 ? 1_555 106.7 ? 15 O ? A ASN 60 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 480 ? 1_555 O ? A VAL 63 ? A VAL 75 ? 1_555 79.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1982-03-04 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _pdbx_entry_details.entry_id 2TGT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE 229 AMINO ACIDS OF TRYPSINOGEN ARE IDENTIFIED BY THE RESIDUE NUMBERS OF THE HOMOLOGOUS CHYMOTRYPSINOGEN. ; # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A THR 125 ? ? 1_555 OG A SER 217 ? ? 4_546 0.78 2 1 C A THR 125 ? ? 1_555 OG A SER 217 ? ? 4_546 1.32 3 1 O A THR 125 ? ? 1_555 CB A SER 217 ? ? 4_546 1.75 4 1 O A ILE 176 ? ? 1_555 O A HOH 844 ? ? 2_655 1.79 5 1 N A SER 127 ? ? 1_555 OG A SER 217 ? ? 4_546 1.85 6 1 O A HOH 835 ? ? 1_555 O A HOH 860 ? ? 5_665 2.03 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE1 A TRP 51 ? ? CE2 A TRP 51 ? ? 1.281 1.371 -0.090 0.013 N 2 1 NE1 A TRP 141 ? ? CE2 A TRP 141 ? ? 1.276 1.371 -0.095 0.013 N 3 1 NE1 A TRP 215 ? ? CE2 A TRP 215 ? ? 1.273 1.371 -0.098 0.013 N 4 1 NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? 1.277 1.371 -0.094 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 71 ? ? -124.04 -77.88 2 1 SER A 190 ? ? -105.48 42.38 3 1 ASP A 194 ? ? 126.55 91.29 4 1 VAL A 213 ? ? -56.67 103.80 5 1 SER A 214 ? ? -102.46 -66.02 6 1 CYS A 220 ? ? 156.58 96.42 7 1 PRO A 225 ? ? -67.04 -178.86 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id GLU _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 70 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -12.58 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ASN A 34 ? ? 0.071 'SIDE CHAIN' 2 1 ASN A 79 ? ? 0.075 'SIDE CHAIN' 3 1 GLN A 81 ? ? 0.071 'SIDE CHAIN' 4 1 GLN A 135 ? ? 0.075 'SIDE CHAIN' 5 1 ASP A 165 ? ? 0.070 'SIDE CHAIN' 6 1 GLN A 210 ? ? 0.090 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A VAL 17 ? N ? A VAL 8 N 2 1 Y 0 A VAL 17 ? CB ? A VAL 8 CB 3 1 Y 0 A VAL 17 ? CG1 ? A VAL 8 CG1 4 1 Y 0 A VAL 17 ? CG2 ? A VAL 8 CG2 5 1 Y 0 A TYR 39 ? OH ? A TYR 28 OH 6 1 Y 0 A SER 61 ? OG ? A SER 50 OG 7 1 Y 0 A LYS 87 ? CE ? A LYS 75 CE 8 1 Y 0 A LYS 87 ? NZ ? A LYS 75 NZ 9 1 Y 0 A LYS 109 ? NZ ? A LYS 97 NZ 10 1 Y 0 A ARG 117 ? NE ? A ARG 105 NE 11 1 Y 0 A ARG 117 ? CZ ? A ARG 105 CZ 12 1 Y 0 A ARG 117 ? NH1 ? A ARG 105 NH1 13 1 Y 0 A ARG 117 ? NH2 ? A ARG 105 NH2 14 1 Y 0 A GLY 142 ? CA ? A GLY 128 CA 15 1 Y 0 A GLY 142 ? C ? A GLY 128 C 16 1 Y 0 A GLY 142 ? O ? A GLY 128 O 17 1 Y 0 A LYS 156 ? NZ ? A LYS 142 NZ 18 1 Y 0 A SER 166 ? OG ? A SER 152 OG 19 1 Y 0 A SER 202 ? OG ? A SER 190 OG 20 1 Y 0 A LYS 204 ? NZ ? A LYS 192 NZ 21 1 Y 0 A LYS 239 ? CE ? A LYS 223 CE 22 1 Y 0 A LYS 239 ? NZ ? A LYS 223 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 10 ? A VAL 1 2 1 Y 1 A ASP 11 ? A ASP 2 3 1 Y 1 A ASP 12 ? A ASP 3 4 1 Y 1 A ASP 13 ? A ASP 4 5 1 Y 1 A ASP 14 ? A ASP 5 6 1 Y 1 A LYS 15 ? A LYS 6 7 1 Y 0 A ILE 16 ? A ILE 7 8 1 Y 0 A ASN 143 ? A ASN 129 9 1 Y 0 A THR 144 ? A THR 130 10 1 Y 0 A LYS 145 ? A LYS 131 11 1 Y 0 A SER 146 ? A SER 132 12 1 Y 0 A SER 147 ? A SER 133 13 1 Y 0 A GLY 148 ? A GLY 134 14 1 Y 0 A THR 149 ? A THR 135 15 1 Y 0 A SER 150 ? A SER 136 16 1 Y 0 A TYR 151 ? A TYR 137 17 1 Y 0 A TYR 184 ? A TYR 171 18 1 Y 0 A LEU 185 ? A LEU 172 19 1 Y 0 A GLU 186 ? A GLU 173 20 1 Y 0 A GLY 187 ? A GLY 174 21 1 Y 0 A GLY 188 A A GLY 175 22 1 Y 0 A LYS 188 ? A LYS 176 23 1 Y 0 A ASP 189 ? A ASP 177 24 1 Y 0 A SER 190 ? A SER 178 25 1 Y 0 A CYS 191 ? A CYS 179 26 1 Y 0 A GLN 192 ? A GLN 180 27 1 Y 0 A GLY 193 ? A GLY 181 28 1 Y 0 A SER 217 ? A SER 201 29 1 Y 0 A GLY 219 ? A GLY 202 30 1 Y 0 A CYS 220 ? A CYS 203 31 1 Y 0 A ALA 221 A A ALA 204 32 1 Y 0 A GLN 221 ? A GLN 205 33 1 Y 0 A LYS 222 ? A LYS 206 34 1 Y 0 A ASN 223 ? A ASN 207 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 METHANOL MOH 4 water HOH #