data_2TN4 # _entry.id 2TN4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2TN4 pdb_00002tn4 10.2210/pdb2tn4/pdb WWPDB D_1000178689 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2TN4 _pdbx_database_status.recvd_initial_deposition_date 1997-09-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Love, M.L.' 1 'Dominguez, R.' 2 'Houdusse, A.' 3 'Cohen, C.' 4 # _citation.id primary _citation.title 'Structures of four Ca2+-bound troponin C at 2.0 A resolution: further insights into the Ca2+-switch in the calmodulin superfamily.' _citation.journal_abbrev Structure _citation.journal_volume 5 _citation.page_first 1695 _citation.page_last 1711 _citation.year 1997 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 9438870 _citation.pdbx_database_id_DOI '10.1016/S0969-2126(97)00315-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Houdusse, A.' 1 ? primary 'Love, M.L.' 2 ? primary 'Dominguez, R.' 3 ? primary 'Grabarek, Z.' 4 ? primary 'Cohen, C.' 5 ? # _cell.entry_id 2TN4 _cell.length_a 83.120 _cell.length_b 51.880 _cell.length_c 52.120 _cell.angle_alpha 90.00 _cell.angle_beta 121.90 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2TN4 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TROPONIN C' 17991.801 1 ? C98L ? 'RABBIT SKELETAL TROPONIN C' 2 non-polymer syn 'CALCIUM ION' 40.078 7 ? ? ? ? 3 water nat water 18.015 97 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TNC # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMV RQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMV RQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ASP n 1 3 GLN n 1 4 GLN n 1 5 ALA n 1 6 GLU n 1 7 ALA n 1 8 ARG n 1 9 SER n 1 10 TYR n 1 11 LEU n 1 12 SER n 1 13 GLU n 1 14 GLU n 1 15 MET n 1 16 ILE n 1 17 ALA n 1 18 GLU n 1 19 PHE n 1 20 LYS n 1 21 ALA n 1 22 ALA n 1 23 PHE n 1 24 ASP n 1 25 MET n 1 26 PHE n 1 27 ASP n 1 28 ALA n 1 29 ASP n 1 30 GLY n 1 31 GLY n 1 32 GLY n 1 33 ASP n 1 34 ILE n 1 35 SER n 1 36 VAL n 1 37 LYS n 1 38 GLU n 1 39 LEU n 1 40 GLY n 1 41 THR n 1 42 VAL n 1 43 MET n 1 44 ARG n 1 45 MET n 1 46 LEU n 1 47 GLY n 1 48 GLN n 1 49 THR n 1 50 PRO n 1 51 THR n 1 52 LYS n 1 53 GLU n 1 54 GLU n 1 55 LEU n 1 56 ASP n 1 57 ALA n 1 58 ILE n 1 59 ILE n 1 60 GLU n 1 61 GLU n 1 62 VAL n 1 63 ASP n 1 64 GLU n 1 65 ASP n 1 66 GLY n 1 67 SER n 1 68 GLY n 1 69 THR n 1 70 ILE n 1 71 ASP n 1 72 PHE n 1 73 GLU n 1 74 GLU n 1 75 PHE n 1 76 LEU n 1 77 VAL n 1 78 MET n 1 79 MET n 1 80 VAL n 1 81 ARG n 1 82 GLN n 1 83 MET n 1 84 LYS n 1 85 GLU n 1 86 ASP n 1 87 ALA n 1 88 LYS n 1 89 GLY n 1 90 LYS n 1 91 SER n 1 92 GLU n 1 93 GLU n 1 94 GLU n 1 95 LEU n 1 96 ALA n 1 97 GLU n 1 98 LEU n 1 99 PHE n 1 100 ARG n 1 101 ILE n 1 102 PHE n 1 103 ASP n 1 104 ARG n 1 105 ASN n 1 106 ALA n 1 107 ASP n 1 108 GLY n 1 109 TYR n 1 110 ILE n 1 111 ASP n 1 112 ALA n 1 113 GLU n 1 114 GLU n 1 115 LEU n 1 116 ALA n 1 117 GLU n 1 118 ILE n 1 119 PHE n 1 120 ARG n 1 121 ALA n 1 122 SER n 1 123 GLY n 1 124 GLU n 1 125 HIS n 1 126 VAL n 1 127 THR n 1 128 ASP n 1 129 GLU n 1 130 GLU n 1 131 ILE n 1 132 GLU n 1 133 SER n 1 134 LEU n 1 135 MET n 1 136 LYS n 1 137 ASP n 1 138 GLY n 1 139 ASP n 1 140 LYS n 1 141 ASN n 1 142 ASN n 1 143 ASP n 1 144 GLY n 1 145 ARG n 1 146 ILE n 1 147 ASP n 1 148 PHE n 1 149 ASP n 1 150 GLU n 1 151 PHE n 1 152 LEU n 1 153 LYS n 1 154 MET n 1 155 MET n 1 156 GLU n 1 157 GLY n 1 158 VAL n 1 159 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus Oryctolagus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue MUSCLE _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC2_RABIT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02586 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMV RQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2TN4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 159 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02586 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 159 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2TN4 _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 98 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P02586 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 98 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 98 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2TN4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.6 _exptl_crystal.density_percent_sol 53.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '54% MPD 50 MM HEPES, PH 7.2 10 MM CACL2 1 MM NA-AZIDE' # _diffrn.id 1 _diffrn.ambient_temp 160 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM' _diffrn_detector.pdbx_collection_date 1997-03-02 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 0.9 _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.910 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline A1 _diffrn_source.pdbx_wavelength 0.910 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2TN4 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20. _reflns.d_resolution_high 2.0 _reflns.number_obs 12852 _reflns.number_all ? _reflns.percent_possible_obs 94.4 _reflns.pdbx_Rmerge_I_obs 0.1090000 _reflns.pdbx_Rsym_value 0.1090000 _reflns.pdbx_netI_over_sigmaI 25. _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.1 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.0 _reflns_shell.d_res_low 2.7 _reflns_shell.percent_possible_all 93.1 _reflns_shell.Rmerge_I_obs 0.1850000 _reflns_shell.pdbx_Rsym_value 0.1850000 _reflns_shell.meanI_over_sigI_obs 27. _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2TN4 _refine.ls_number_reflns_obs 12305 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10. _refine.ls_d_res_high 2.0 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2120000 _refine.ls_R_factor_R_free 0.2650000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 615 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method 'A POSTERIORI' _refine.details 'X-PLOR (BRUNGER) ALSO WAS USED.' _refine.pdbx_starting_model 'PDB ENTRY 1TN4' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details 'RANDOM R VALUE (WORKING + TEST SET) : NULL' _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1226 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 1330 _refine_hist.d_res_high 2.0 _refine_hist.d_res_low 10. # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function o_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? o_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d 22.3 ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d 2.2 ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? o_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? o_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? o_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2TN4 _struct.title 'FOUR CALCIUM TNC' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2TN4 _struct_keywords.pdbx_keywords 'CONTRACTILE SYSTEM PROTEIN' _struct_keywords.text 'CONTRACTILE SYSTEM PROTEIN, CALCIUM REGULATION, CALMODULIN SUPERFAMILY' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 2 ? TYR A 10 ? ASP A 2 TYR A 10 1 ? 9 HELX_P HELX_P2 2 GLU A 13 ? PHE A 26 ? GLU A 13 PHE A 26 1 ? 14 HELX_P HELX_P3 3 VAL A 36 ? LEU A 46 ? VAL A 36 LEU A 46 1 ? 11 HELX_P HELX_P4 4 LYS A 52 ? VAL A 62 ? LYS A 52 VAL A 62 1 ? 11 HELX_P HELX_P5 5 PHE A 72 ? PHE A 102 ? PHE A 72 PHE A 102 1 ? 31 HELX_P HELX_P6 6 ALA A 112 ? ALA A 121 ? ALA A 112 ALA A 121 1 ? 10 HELX_P HELX_P7 7 ASP A 128 ? GLY A 138 ? ASP A 128 GLY A 138 1 ? 11 HELX_P HELX_P8 8 PHE A 148 ? LYS A 153 ? PHE A 148 LYS A 153 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 27 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 27 A CA 160 1_555 ? ? ? ? ? ? ? 2.357 ? ? metalc2 metalc ? ? A ASP 29 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 29 A CA 160 1_555 ? ? ? ? ? ? ? 2.519 ? ? metalc3 metalc ? ? A ASP 33 O ? ? ? 1_555 B CA . CA ? ? A ASP 33 A CA 160 1_555 ? ? ? ? ? ? ? 2.329 ? ? metalc4 metalc ? ? A GLU 38 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 38 A CA 160 1_555 ? ? ? ? ? ? ? 2.608 ? ? metalc5 metalc ? ? A GLU 38 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 38 A CA 160 1_555 ? ? ? ? ? ? ? 2.619 ? ? metalc6 metalc ? ? A THR 49 O ? ? ? 1_555 G CA . CA ? ? A THR 49 A CA 165 1_555 ? ? ? ? ? ? ? 2.385 ? ? metalc7 metalc ? ? A THR 49 OG1 ? ? ? 1_555 G CA . CA ? ? A THR 49 A CA 165 1_555 ? ? ? ? ? ? ? 2.627 ? ? metalc8 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 H CA . CA ? ? A ASP 56 A CA 166 1_555 ? ? ? ? ? ? ? 2.472 ? ? metalc9 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 H CA . CA ? ? A ASP 56 A CA 166 1_555 ? ? ? ? ? ? ? 2.662 ? ? metalc10 metalc ? ? A GLU 60 OE1 ? ? ? 1_555 F CA . CA ? ? A GLU 60 A CA 164 1_555 ? ? ? ? ? ? ? 2.579 ? ? metalc11 metalc ? ? A GLU 60 OE2 ? ? ? 1_555 F CA . CA ? ? A GLU 60 A CA 164 1_555 ? ? ? ? ? ? ? 2.561 ? ? metalc12 metalc ? ? A GLU 60 OE2 ? ? ? 1_555 H CA . CA ? ? A GLU 60 A CA 166 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc13 metalc ? ? A ASP 63 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 63 A CA 161 1_555 ? ? ? ? ? ? ? 2.388 ? ? metalc14 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 161 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc15 metalc ? ? A SER 67 OG ? ? ? 1_555 C CA . CA ? ? A SER 67 A CA 161 1_555 ? ? ? ? ? ? ? 2.638 ? ? metalc16 metalc ? ? A THR 69 O ? ? ? 1_555 C CA . CA ? ? A THR 69 A CA 161 1_555 ? ? ? ? ? ? ? 2.481 ? ? metalc17 metalc ? ? A GLU 73 OE1 ? ? ? 4_545 G CA . CA ? ? A GLU 73 A CA 165 1_555 ? ? ? ? ? ? ? 2.481 ? ? metalc18 metalc ? ? A GLU 74 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 74 A CA 161 1_555 ? ? ? ? ? ? ? 2.599 ? ? metalc19 metalc ? ? A GLU 74 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 74 A CA 161 1_555 ? ? ? ? ? ? ? 2.580 ? ? metalc20 metalc ? ? A ASP 103 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 103 A CA 162 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc21 metalc ? ? A ASN 105 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 105 A CA 162 1_555 ? ? ? ? ? ? ? 2.487 ? ? metalc22 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 107 A CA 162 1_555 ? ? ? ? ? ? ? 2.460 ? ? metalc23 metalc ? ? A TYR 109 O ? ? ? 1_555 D CA . CA ? ? A TYR 109 A CA 162 1_555 ? ? ? ? ? ? ? 2.416 ? ? metalc24 metalc ? ? A GLU 114 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 114 A CA 162 1_555 ? ? ? ? ? ? ? 2.374 ? ? metalc25 metalc ? ? A GLU 114 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 114 A CA 162 1_555 ? ? ? ? ? ? ? 2.459 ? ? metalc26 metalc ? ? A GLU 124 OE2 ? ? ? 3_454 F CA . CA ? ? A GLU 124 A CA 164 1_555 ? ? ? ? ? ? ? 2.583 ? ? metalc27 metalc ? ? A GLU 124 OE1 ? ? ? 3_454 H CA . CA ? ? A GLU 124 A CA 166 1_555 ? ? ? ? ? ? ? 2.603 ? ? metalc28 metalc ? ? A GLU 124 OE2 ? ? ? 3_454 H CA . CA ? ? A GLU 124 A CA 166 1_555 ? ? ? ? ? ? ? 2.782 ? ? metalc29 metalc ? ? A HIS 125 O ? ? ? 3_454 F CA . CA ? ? A HIS 125 A CA 164 1_555 ? ? ? ? ? ? ? 2.355 ? ? metalc30 metalc ? ? A ASP 139 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 139 A CA 163 1_555 ? ? ? ? ? ? ? 2.421 ? ? metalc31 metalc ? ? A ASN 141 OD1 ? ? ? 1_555 E CA . CA ? ? A ASN 141 A CA 163 1_555 ? ? ? ? ? ? ? 2.275 ? ? metalc32 metalc ? ? A ASP 143 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 143 A CA 163 1_555 ? ? ? ? ? ? ? 2.473 ? ? metalc33 metalc ? ? A ARG 145 O ? ? ? 1_555 E CA . CA ? ? A ARG 145 A CA 163 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc34 metalc ? ? A GLU 150 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 150 A CA 163 1_555 ? ? ? ? ? ? ? 2.681 ? ? metalc35 metalc ? ? A GLU 150 OE1 ? ? ? 1_555 E CA . CA ? ? A GLU 150 A CA 163 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc36 metalc ? ? B CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 160 A HOH 173 1_555 ? ? ? ? ? ? ? 2.474 ? ? metalc37 metalc ? ? B CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 160 A HOH 221 1_555 ? ? ? ? ? ? ? 2.557 ? ? metalc38 metalc ? ? C CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 161 A HOH 188 1_555 ? ? ? ? ? ? ? 2.483 ? ? metalc39 metalc ? ? D CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 162 A HOH 232 1_555 ? ? ? ? ? ? ? 2.540 ? ? metalc40 metalc ? ? E CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 163 A HOH 175 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc41 metalc ? ? F CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 164 A HOH 216 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc42 metalc ? ? G CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 165 A HOH 169 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc43 metalc ? ? G CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 165 A HOH 172 1_555 ? ? ? ? ? ? ? 2.478 ? ? metalc44 metalc ? ? G CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 165 A HOH 233 1_555 ? ? ? ? ? ? ? 2.469 ? ? metalc45 metalc ? ? G CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 165 A HOH 237 4_545 ? ? ? ? ? ? ? 2.776 ? ? metalc46 metalc ? ? H CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 166 A HOH 191 1_555 ? ? ? ? ? ? ? 2.683 ? ? metalc47 metalc ? ? H CA . CA ? ? ? 1_555 I HOH . O ? ? A CA 166 A HOH 195 1_555 ? ? ? ? ? ? ? 2.778 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 33 ? ILE A 34 ? ASP A 33 ILE A 34 A 2 ILE A 70 ? ASP A 71 ? ILE A 70 ASP A 71 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 34 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 34 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 70 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 70 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 160 ? 6 'BINDING SITE FOR RESIDUE CA A 160' AC2 Software A CA 161 ? 6 'BINDING SITE FOR RESIDUE CA A 161' AC3 Software A CA 162 ? 6 'BINDING SITE FOR RESIDUE CA A 162' AC4 Software A CA 163 ? 6 'BINDING SITE FOR RESIDUE CA A 163' AC5 Software A CA 164 ? 4 'BINDING SITE FOR RESIDUE CA A 164' AC6 Software A CA 165 ? 6 'BINDING SITE FOR RESIDUE CA A 165' AC7 Software A CA 166 ? 5 'BINDING SITE FOR RESIDUE CA A 166' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 27 ? ASP A 27 . ? 1_555 ? 2 AC1 6 ASP A 29 ? ASP A 29 . ? 1_555 ? 3 AC1 6 ASP A 33 ? ASP A 33 . ? 1_555 ? 4 AC1 6 GLU A 38 ? GLU A 38 . ? 1_555 ? 5 AC1 6 HOH I . ? HOH A 173 . ? 1_555 ? 6 AC1 6 HOH I . ? HOH A 221 . ? 1_555 ? 7 AC2 6 ASP A 63 ? ASP A 63 . ? 1_555 ? 8 AC2 6 ASP A 65 ? ASP A 65 . ? 1_555 ? 9 AC2 6 SER A 67 ? SER A 67 . ? 1_555 ? 10 AC2 6 THR A 69 ? THR A 69 . ? 1_555 ? 11 AC2 6 GLU A 74 ? GLU A 74 . ? 1_555 ? 12 AC2 6 HOH I . ? HOH A 188 . ? 1_555 ? 13 AC3 6 ASP A 103 ? ASP A 103 . ? 1_555 ? 14 AC3 6 ASN A 105 ? ASN A 105 . ? 1_555 ? 15 AC3 6 ASP A 107 ? ASP A 107 . ? 1_555 ? 16 AC3 6 TYR A 109 ? TYR A 109 . ? 1_555 ? 17 AC3 6 GLU A 114 ? GLU A 114 . ? 1_555 ? 18 AC3 6 HOH I . ? HOH A 232 . ? 1_555 ? 19 AC4 6 ASP A 139 ? ASP A 139 . ? 1_555 ? 20 AC4 6 ASN A 141 ? ASN A 141 . ? 1_555 ? 21 AC4 6 ASP A 143 ? ASP A 143 . ? 1_555 ? 22 AC4 6 ARG A 145 ? ARG A 145 . ? 1_555 ? 23 AC4 6 GLU A 150 ? GLU A 150 . ? 1_555 ? 24 AC4 6 HOH I . ? HOH A 175 . ? 1_555 ? 25 AC5 4 GLU A 60 ? GLU A 60 . ? 1_555 ? 26 AC5 4 GLU A 124 ? GLU A 124 . ? 3_454 ? 27 AC5 4 HIS A 125 ? HIS A 125 . ? 3_454 ? 28 AC5 4 HOH I . ? HOH A 216 . ? 1_555 ? 29 AC6 6 THR A 49 ? THR A 49 . ? 1_555 ? 30 AC6 6 GLU A 73 ? GLU A 73 . ? 4_545 ? 31 AC6 6 HOH I . ? HOH A 169 . ? 1_555 ? 32 AC6 6 HOH I . ? HOH A 172 . ? 1_555 ? 33 AC6 6 HOH I . ? HOH A 233 . ? 1_555 ? 34 AC6 6 HOH I . ? HOH A 237 . ? 4_545 ? 35 AC7 5 ASP A 56 ? ASP A 56 . ? 1_555 ? 36 AC7 5 GLU A 60 ? GLU A 60 . ? 1_555 ? 37 AC7 5 GLU A 124 ? GLU A 124 . ? 3_454 ? 38 AC7 5 HOH I . ? HOH A 191 . ? 1_555 ? 39 AC7 5 HOH I . ? HOH A 195 . ? 1_555 ? # _database_PDB_matrix.entry_id 2TN4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2TN4 _atom_sites.fract_transf_matrix[1][1] 0.012031 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007489 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019275 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022600 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 MET 43 43 43 MET MET A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 MET 78 78 78 MET MET A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 ASN 142 142 142 ASN ASN A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 MET 154 154 154 MET MET A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 GLU 156 156 ? ? ? A . n A 1 157 GLY 157 157 ? ? ? A . n A 1 158 VAL 158 158 ? ? ? A . n A 1 159 GLN 159 159 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 160 1 CA CA A . C 2 CA 1 161 2 CA CA A . D 2 CA 1 162 3 CA CA A . E 2 CA 1 163 4 CA CA A . F 2 CA 1 164 5 CA CA A . G 2 CA 1 165 6 CA CA A . H 2 CA 1 166 7 CA CA A . I 3 HOH 1 167 1 HOH HOH A . I 3 HOH 2 168 2 HOH HOH A . I 3 HOH 3 169 3 HOH HOH A . I 3 HOH 4 170 4 HOH HOH A . I 3 HOH 5 171 5 HOH HOH A . I 3 HOH 6 172 6 HOH HOH A . I 3 HOH 7 173 7 HOH HOH A . I 3 HOH 8 174 8 HOH HOH A . I 3 HOH 9 175 9 HOH HOH A . I 3 HOH 10 176 10 HOH HOH A . I 3 HOH 11 177 11 HOH HOH A . I 3 HOH 12 178 12 HOH HOH A . I 3 HOH 13 179 13 HOH HOH A . I 3 HOH 14 180 14 HOH HOH A . I 3 HOH 15 181 15 HOH HOH A . I 3 HOH 16 182 16 HOH HOH A . I 3 HOH 17 183 17 HOH HOH A . I 3 HOH 18 184 18 HOH HOH A . I 3 HOH 19 185 19 HOH HOH A . I 3 HOH 20 186 20 HOH HOH A . I 3 HOH 21 187 21 HOH HOH A . I 3 HOH 22 188 22 HOH HOH A . I 3 HOH 23 189 23 HOH HOH A . I 3 HOH 24 190 24 HOH HOH A . I 3 HOH 25 191 25 HOH HOH A . I 3 HOH 26 192 26 HOH HOH A . I 3 HOH 27 193 27 HOH HOH A . I 3 HOH 28 194 28 HOH HOH A . I 3 HOH 29 195 29 HOH HOH A . I 3 HOH 30 196 30 HOH HOH A . I 3 HOH 31 197 31 HOH HOH A . I 3 HOH 32 198 32 HOH HOH A . I 3 HOH 33 199 33 HOH HOH A . I 3 HOH 34 200 34 HOH HOH A . I 3 HOH 35 201 35 HOH HOH A . I 3 HOH 36 202 36 HOH HOH A . I 3 HOH 37 203 37 HOH HOH A . I 3 HOH 38 204 38 HOH HOH A . I 3 HOH 39 205 39 HOH HOH A . I 3 HOH 40 206 40 HOH HOH A . I 3 HOH 41 207 41 HOH HOH A . I 3 HOH 42 208 42 HOH HOH A . I 3 HOH 43 209 43 HOH HOH A . I 3 HOH 44 210 44 HOH HOH A . I 3 HOH 45 211 45 HOH HOH A . I 3 HOH 46 212 46 HOH HOH A . I 3 HOH 47 213 47 HOH HOH A . I 3 HOH 48 214 48 HOH HOH A . I 3 HOH 49 215 49 HOH HOH A . I 3 HOH 50 216 50 HOH HOH A . I 3 HOH 51 217 51 HOH HOH A . I 3 HOH 52 218 52 HOH HOH A . I 3 HOH 53 219 53 HOH HOH A . I 3 HOH 54 220 54 HOH HOH A . I 3 HOH 55 221 55 HOH HOH A . I 3 HOH 56 222 56 HOH HOH A . I 3 HOH 57 223 57 HOH HOH A . I 3 HOH 58 224 58 HOH HOH A . I 3 HOH 59 225 59 HOH HOH A . I 3 HOH 60 226 60 HOH HOH A . I 3 HOH 61 227 61 HOH HOH A . I 3 HOH 62 228 62 HOH HOH A . I 3 HOH 63 229 63 HOH HOH A . I 3 HOH 64 230 64 HOH HOH A . I 3 HOH 65 231 65 HOH HOH A . I 3 HOH 66 232 66 HOH HOH A . I 3 HOH 67 233 67 HOH HOH A . I 3 HOH 68 234 68 HOH HOH A . I 3 HOH 69 235 69 HOH HOH A . I 3 HOH 70 236 70 HOH HOH A . I 3 HOH 71 237 71 HOH HOH A . I 3 HOH 72 238 72 HOH HOH A . I 3 HOH 73 239 73 HOH HOH A . I 3 HOH 74 240 74 HOH HOH A . I 3 HOH 75 241 75 HOH HOH A . I 3 HOH 76 242 76 HOH HOH A . I 3 HOH 77 243 77 HOH HOH A . I 3 HOH 78 244 78 HOH HOH A . I 3 HOH 79 245 79 HOH HOH A . I 3 HOH 80 246 80 HOH HOH A . I 3 HOH 81 247 81 HOH HOH A . I 3 HOH 82 248 82 HOH HOH A . I 3 HOH 83 249 83 HOH HOH A . I 3 HOH 84 250 84 HOH HOH A . I 3 HOH 85 251 85 HOH HOH A . I 3 HOH 86 252 86 HOH HOH A . I 3 HOH 87 253 87 HOH HOH A . I 3 HOH 88 254 88 HOH HOH A . I 3 HOH 89 255 89 HOH HOH A . I 3 HOH 90 256 90 HOH HOH A . I 3 HOH 91 257 91 HOH HOH A . I 3 HOH 92 258 92 HOH HOH A . I 3 HOH 93 259 93 HOH HOH A . I 3 HOH 94 260 94 HOH HOH A . I 3 HOH 95 261 95 HOH HOH A . I 3 HOH 96 262 96 HOH HOH A . I 3 HOH 97 263 97 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OD1 ? A ASP 29 ? A ASP 29 ? 1_555 80.4 ? 2 OD1 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? A ASP 33 ? A ASP 33 ? 1_555 77.3 ? 3 OD1 ? A ASP 29 ? A ASP 29 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? A ASP 33 ? A ASP 33 ? 1_555 149.5 ? 4 OD1 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE1 ? A GLU 38 ? A GLU 38 ? 1_555 105.8 ? 5 OD1 ? A ASP 29 ? A ASP 29 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE1 ? A GLU 38 ? A GLU 38 ? 1_555 124.6 ? 6 O ? A ASP 33 ? A ASP 33 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE1 ? A GLU 38 ? A GLU 38 ? 1_555 81.8 ? 7 OD1 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE2 ? A GLU 38 ? A GLU 38 ? 1_555 98.2 ? 8 OD1 ? A ASP 29 ? A ASP 29 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE2 ? A GLU 38 ? A GLU 38 ? 1_555 75.6 ? 9 O ? A ASP 33 ? A ASP 33 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE2 ? A GLU 38 ? A GLU 38 ? 1_555 127.9 ? 10 OE1 ? A GLU 38 ? A GLU 38 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 OE2 ? A GLU 38 ? A GLU 38 ? 1_555 49.1 ? 11 OD1 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 173 ? 1_555 94.8 ? 12 OD1 ? A ASP 29 ? A ASP 29 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 173 ? 1_555 86.2 ? 13 O ? A ASP 33 ? A ASP 33 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 173 ? 1_555 75.3 ? 14 OE1 ? A GLU 38 ? A GLU 38 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 173 ? 1_555 144.9 ? 15 OE2 ? A GLU 38 ? A GLU 38 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 173 ? 1_555 155.4 ? 16 OD1 ? A ASP 27 ? A ASP 27 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 221 ? 1_555 173.3 ? 17 OD1 ? A ASP 29 ? A ASP 29 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 221 ? 1_555 95.0 ? 18 O ? A ASP 33 ? A ASP 33 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 221 ? 1_555 105.1 ? 19 OE1 ? A GLU 38 ? A GLU 38 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 221 ? 1_555 80.8 ? 20 OE2 ? A GLU 38 ? A GLU 38 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 221 ? 1_555 85.3 ? 21 O ? I HOH . ? A HOH 173 ? 1_555 CA ? B CA . ? A CA 160 ? 1_555 O ? I HOH . ? A HOH 221 ? 1_555 79.9 ? 22 O ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 OG1 ? A THR 49 ? A THR 49 ? 1_555 66.1 ? 23 O ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 4_545 155.4 ? 24 OG1 ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 4_545 132.1 ? 25 O ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 169 ? 1_555 92.4 ? 26 OG1 ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 169 ? 1_555 155.1 ? 27 OE1 ? A GLU 73 ? A GLU 73 ? 4_545 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 169 ? 1_555 72.4 ? 28 O ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 172 ? 1_555 83.9 ? 29 OG1 ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 172 ? 1_555 88.2 ? 30 OE1 ? A GLU 73 ? A GLU 73 ? 4_545 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 172 ? 1_555 80.8 ? 31 O ? I HOH . ? A HOH 169 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 172 ? 1_555 102.5 ? 32 O ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 233 ? 1_555 88.2 ? 33 OG1 ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 233 ? 1_555 87.3 ? 34 OE1 ? A GLU 73 ? A GLU 73 ? 4_545 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 233 ? 1_555 107.1 ? 35 O ? I HOH . ? A HOH 169 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 233 ? 1_555 79.3 ? 36 O ? I HOH . ? A HOH 172 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 233 ? 1_555 172.0 ? 37 O ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 237 ? 4_545 133.5 ? 38 OG1 ? A THR 49 ? A THR 49 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 237 ? 4_545 70.4 ? 39 OE1 ? A GLU 73 ? A GLU 73 ? 4_545 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 237 ? 4_545 70.4 ? 40 O ? I HOH . ? A HOH 169 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 237 ? 4_545 124.4 ? 41 O ? I HOH . ? A HOH 172 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 237 ? 4_545 110.6 ? 42 O ? I HOH . ? A HOH 233 ? 1_555 CA ? G CA . ? A CA 165 ? 1_555 O ? I HOH . ? A HOH 237 ? 4_545 74.0 ? 43 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 49.6 ? 44 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 93.3 ? 45 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 76.5 ? 46 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE1 ? A GLU 124 ? A GLU 124 ? 3_454 109.9 ? 47 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE1 ? A GLU 124 ? A GLU 124 ? 3_454 78.4 ? 48 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE1 ? A GLU 124 ? A GLU 124 ? 3_454 119.6 ? 49 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 127.1 ? 50 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 77.6 ? 51 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 73.4 ? 52 OE1 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? H CA . ? A CA 166 ? 1_555 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 47.8 ? 53 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 191 ? 1_555 73.3 ? 54 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 191 ? 1_555 116.6 ? 55 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 191 ? 1_555 82.6 ? 56 OE1 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 191 ? 1_555 156.7 ? 57 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 191 ? 1_555 148.5 ? 58 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 195 ? 1_555 150.9 ? 59 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 195 ? 1_555 149.1 ? 60 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 195 ? 1_555 78.8 ? 61 OE1 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 195 ? 1_555 98.2 ? 62 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 195 ? 1_555 77.7 ? 63 O ? I HOH . ? A HOH 191 ? 1_555 CA ? H CA . ? A CA 166 ? 1_555 O ? I HOH . ? A HOH 195 ? 1_555 77.9 ? 64 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 49.1 ? 65 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 116.9 ? 66 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 74.1 ? 67 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 O ? A HIS 125 ? A HIS 125 ? 3_454 86.7 ? 68 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 O ? A HIS 125 ? A HIS 125 ? 3_454 108.0 ? 69 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? F CA . ? A CA 164 ? 1_555 O ? A HIS 125 ? A HIS 125 ? 3_454 87.1 ? 70 OE1 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 O ? I HOH . ? A HOH 216 ? 1_555 172.7 ? 71 OE2 ? A GLU 60 ? A GLU 60 ? 1_555 CA ? F CA . ? A CA 164 ? 1_555 O ? I HOH . ? A HOH 216 ? 1_555 134.9 ? 72 OE2 ? A GLU 124 ? A GLU 124 ? 3_454 CA ? F CA . ? A CA 164 ? 1_555 O ? I HOH . ? A HOH 216 ? 1_555 69.9 ? 73 O ? A HIS 125 ? A HIS 125 ? 3_454 CA ? F CA . ? A CA 164 ? 1_555 O ? I HOH . ? A HOH 216 ? 1_555 96.5 ? 74 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 79.8 ? 75 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OG ? A SER 67 ? A SER 67 ? 1_555 90.0 ? 76 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OG ? A SER 67 ? A SER 67 ? 1_555 80.1 ? 77 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? A THR 69 ? A THR 69 ? 1_555 82.9 ? 78 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? A THR 69 ? A THR 69 ? 1_555 153.0 ? 79 OG ? A SER 67 ? A SER 67 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? A THR 69 ? A THR 69 ? 1_555 79.4 ? 80 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 89.8 ? 81 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 80.4 ? 82 OG ? A SER 67 ? A SER 67 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 160.2 ? 83 O ? A THR 69 ? A THR 69 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 120.2 ? 84 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 107.2 ? 85 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 129.1 ? 86 OG ? A SER 67 ? A SER 67 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 147.6 ? 87 O ? A THR 69 ? A THR 69 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 75.9 ? 88 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 50.0 ? 89 OD1 ? A ASP 63 ? A ASP 63 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? I HOH . ? A HOH 188 ? 1_555 162.3 ? 90 OD1 ? A ASP 65 ? A ASP 65 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? I HOH . ? A HOH 188 ? 1_555 83.0 ? 91 OG ? A SER 67 ? A SER 67 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? I HOH . ? A HOH 188 ? 1_555 83.3 ? 92 O ? A THR 69 ? A THR 69 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? I HOH . ? A HOH 188 ? 1_555 111.7 ? 93 OE2 ? A GLU 74 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? I HOH . ? A HOH 188 ? 1_555 91.0 ? 94 OE1 ? A GLU 74 ? A GLU 74 ? 1_555 CA ? C CA . ? A CA 161 ? 1_555 O ? I HOH . ? A HOH 188 ? 1_555 86.6 ? 95 OD1 ? A ASP 103 ? A ASP 103 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 84.2 ? 96 OD1 ? A ASP 103 ? A ASP 103 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OD1 ? A ASP 107 ? A ASP 107 ? 1_555 79.3 ? 97 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OD1 ? A ASP 107 ? A ASP 107 ? 1_555 77.2 ? 98 OD1 ? A ASP 103 ? A ASP 103 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? A TYR 109 ? A TYR 109 ? 1_555 81.4 ? 99 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? A TYR 109 ? A TYR 109 ? 1_555 155.8 ? 100 OD1 ? A ASP 107 ? A ASP 107 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? A TYR 109 ? A TYR 109 ? 1_555 81.1 ? 101 OD1 ? A ASP 103 ? A ASP 103 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE1 ? A GLU 114 ? A GLU 114 ? 1_555 113.9 ? 102 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE1 ? A GLU 114 ? A GLU 114 ? 1_555 125.5 ? 103 OD1 ? A ASP 107 ? A ASP 107 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE1 ? A GLU 114 ? A GLU 114 ? 1_555 153.3 ? 104 O ? A TYR 109 ? A TYR 109 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE1 ? A GLU 114 ? A GLU 114 ? 1_555 78.4 ? 105 OD1 ? A ASP 103 ? A ASP 103 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 97.2 ? 106 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 74.4 ? 107 OD1 ? A ASP 107 ? A ASP 107 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 151.6 ? 108 O ? A TYR 109 ? A TYR 109 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 126.6 ? 109 OE1 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 53.3 ? 110 OD1 ? A ASP 103 ? A ASP 103 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? I HOH . ? A HOH 232 ? 1_555 162.7 ? 111 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? I HOH . ? A HOH 232 ? 1_555 88.2 ? 112 OD1 ? A ASP 107 ? A ASP 107 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? I HOH . ? A HOH 232 ? 1_555 83.9 ? 113 O ? A TYR 109 ? A TYR 109 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? I HOH . ? A HOH 232 ? 1_555 100.0 ? 114 OE1 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? I HOH . ? A HOH 232 ? 1_555 83.1 ? 115 OE2 ? A GLU 114 ? A GLU 114 ? 1_555 CA ? D CA . ? A CA 162 ? 1_555 O ? I HOH . ? A HOH 232 ? 1_555 95.7 ? 116 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OD1 ? A ASN 141 ? A ASN 141 ? 1_555 80.4 ? 117 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 83.5 ? 118 OD1 ? A ASN 141 ? A ASN 141 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 85.3 ? 119 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? A ARG 145 ? A ARG 145 ? 1_555 81.1 ? 120 OD1 ? A ASN 141 ? A ASN 141 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? A ARG 145 ? A ARG 145 ? 1_555 157.7 ? 121 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? A ARG 145 ? A ARG 145 ? 1_555 80.2 ? 122 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE2 ? A GLU 150 ? A GLU 150 ? 1_555 88.1 ? 123 OD1 ? A ASN 141 ? A ASN 141 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE2 ? A GLU 150 ? A GLU 150 ? 1_555 74.5 ? 124 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE2 ? A GLU 150 ? A GLU 150 ? 1_555 159.2 ? 125 O ? A ARG 145 ? A ARG 145 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE2 ? A GLU 150 ? A GLU 150 ? 1_555 117.2 ? 126 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE1 ? A GLU 150 ? A GLU 150 ? 1_555 112.0 ? 127 OD1 ? A ASN 141 ? A ASN 141 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE1 ? A GLU 150 ? A GLU 150 ? 1_555 121.2 ? 128 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE1 ? A GLU 150 ? A GLU 150 ? 1_555 150.3 ? 129 O ? A ARG 145 ? A ARG 145 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE1 ? A GLU 150 ? A GLU 150 ? 1_555 77.6 ? 130 OE2 ? A GLU 150 ? A GLU 150 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 OE1 ? A GLU 150 ? A GLU 150 ? 1_555 50.3 ? 131 OD1 ? A ASP 139 ? A ASP 139 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? I HOH . ? A HOH 175 ? 1_555 160.8 ? 132 OD1 ? A ASN 141 ? A ASN 141 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? I HOH . ? A HOH 175 ? 1_555 89.5 ? 133 OD1 ? A ASP 143 ? A ASP 143 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? I HOH . ? A HOH 175 ? 1_555 79.4 ? 134 O ? A ARG 145 ? A ARG 145 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? I HOH . ? A HOH 175 ? 1_555 104.4 ? 135 OE2 ? A GLU 150 ? A GLU 150 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? I HOH . ? A HOH 175 ? 1_555 105.1 ? 136 OE1 ? A GLU 150 ? A GLU 150 ? 1_555 CA ? E CA . ? A CA 163 ? 1_555 O ? I HOH . ? A HOH 175 ? 1_555 87.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1998-04-08 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif 5 4 'Structure model' struct_site 6 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 19 4 'Structure model' '_pdbx_struct_conn_angle.value' 20 4 'Structure model' '_struct_conn.pdbx_dist_value' 21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 4 'Structure model' '_struct_conn.ptnr1_symmetry' 28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 4 'Structure model' '_struct_conn.ptnr2_symmetry' 35 4 'Structure model' '_struct_ref_seq_dif.details' 36 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 37 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 38 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 ARP/wARP 'model building' . ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 168 ? ? O A HOH 189 ? ? 2.02 2 1 O A HOH 219 ? ? O A HOH 234 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 256 ? ? 1_555 O A HOH 256 ? ? 2_656 1.81 2 1 O A HOH 248 ? ? 1_555 O A HOH 255 ? ? 4_556 1.93 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -17.33 -63.42 2 1 ASP A 27 ? ? -65.86 71.42 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ARG _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 100 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 10.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 156 ? A GLU 156 2 1 Y 1 A GLY 157 ? A GLY 157 3 1 Y 1 A VAL 158 ? A VAL 158 4 1 Y 1 A GLN 159 ? A GLN 159 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1TN4 _pdbx_initial_refinement_model.details 'PDB ENTRY 1TN4' #