data_2UVM # _entry.id 2UVM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2UVM PDBE EBI-31884 WWPDB D_1290031884 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1H10 unspecified 'HIGH RESOLUTION STRUCTURE OF THE PLECKSTRIN HOMOLOGY DOMAIN OF PROTEIN KINASE B/AKT BOUND TO INS(1,3,4,5)-TETRAKISPHOPHATE' PDB 1UNP unspecified 'CRYSTAL STRUCTURE OF THE PLECKSTRIN HOMOLOGY DOMAIN OF PKB ALPHA' PDB 1UNQ unspecified 'HIGH RESOLUTION CRYSTAL STRUCTURE OF THE PLECKSTRIN HOMOLOGY DOMAIN OF PROTEIN KINASE B/AKT BOUND TO INS(1,3,4,5)- TETRAKISPHOPHATE' PDB 1UNR unspecified 'CRYSTAL STRUCTURE OF THE PH DOMAIN OF PKB ALPHA IN COMPLEX WITH A SULFATE MOLECULE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2UVM _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2007-03-12 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Komander, D.' 1 'Mills, S.J.' 2 'Trusselle, M.N.' 3 'Safrany, S.T.' 4 'van Aalten, D.M.F.' 5 'Potter, B.V.L.' 6 # _citation.id primary _citation.title 'Novel Inositol Phospholipid Headgroup Surrogate Crystallised in the Pleckstrin Homology Domain of Protein Kinase Balpha.' _citation.journal_abbrev 'Acs Chem.Biol.' _citation.journal_volume 2 _citation.page_first 242 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1554-8929 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17432822 _citation.pdbx_database_id_DOI 10.1021/CB700019R # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mills, S.J.' 1 primary 'Komander, D.' 2 primary 'Trusselle, M.N.' 3 primary 'Safrany, S.T.' 4 primary 'Van Aalten, D.M.F.' 5 primary 'Potter, B.V.L.' 6 # _cell.entry_id 2UVM _cell.length_a 80.029 _cell.length_b 34.040 _cell.length_c 44.944 _cell.angle_alpha 90.00 _cell.angle_beta 112.25 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2UVM _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE' 14686.589 1 2.7.11.1 ? 'PLECKSTRIN HOMOLOGY (PH) DOMAIN, RESIDUES 1-123' ? 2 non-polymer syn 'BENZENE-1,2,3,4-TETRAYL TETRAKIS[DIHYDROGEN (PHOSPHATE)]' 462.029 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 water nat water 18.015 53 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PROTEIN KINASE B ALPHA, RAC-PK-ALPHA, PROTEIN KINASE B, PKB, C-AKT' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQW TTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQW TTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 VAL n 1 5 ALA n 1 6 ILE n 1 7 VAL n 1 8 LYS n 1 9 GLU n 1 10 GLY n 1 11 TRP n 1 12 LEU n 1 13 HIS n 1 14 LYS n 1 15 ARG n 1 16 GLY n 1 17 GLU n 1 18 TYR n 1 19 ILE n 1 20 LYS n 1 21 THR n 1 22 TRP n 1 23 ARG n 1 24 PRO n 1 25 ARG n 1 26 TYR n 1 27 PHE n 1 28 LEU n 1 29 LEU n 1 30 LYS n 1 31 ASN n 1 32 ASP n 1 33 GLY n 1 34 THR n 1 35 PHE n 1 36 ILE n 1 37 GLY n 1 38 TYR n 1 39 LYS n 1 40 GLU n 1 41 ARG n 1 42 PRO n 1 43 GLN n 1 44 ASP n 1 45 VAL n 1 46 ASP n 1 47 GLN n 1 48 ARG n 1 49 GLU n 1 50 ALA n 1 51 PRO n 1 52 LEU n 1 53 ASN n 1 54 ASN n 1 55 PHE n 1 56 SER n 1 57 VAL n 1 58 ALA n 1 59 GLN n 1 60 CYS n 1 61 GLN n 1 62 LEU n 1 63 MET n 1 64 LYS n 1 65 THR n 1 66 GLU n 1 67 ARG n 1 68 PRO n 1 69 ARG n 1 70 PRO n 1 71 ASN n 1 72 THR n 1 73 PHE n 1 74 ILE n 1 75 ILE n 1 76 ARG n 1 77 CYS n 1 78 LEU n 1 79 GLN n 1 80 TRP n 1 81 THR n 1 82 THR n 1 83 VAL n 1 84 ILE n 1 85 GLU n 1 86 ARG n 1 87 THR n 1 88 PHE n 1 89 HIS n 1 90 VAL n 1 91 GLU n 1 92 THR n 1 93 PRO n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 GLU n 1 98 GLU n 1 99 TRP n 1 100 THR n 1 101 THR n 1 102 ALA n 1 103 ILE n 1 104 GLN n 1 105 THR n 1 106 VAL n 1 107 ALA n 1 108 ASP n 1 109 GLY n 1 110 LEU n 1 111 LYS n 1 112 LYS n 1 113 GLN n 1 114 GLU n 1 115 GLU n 1 116 GLU n 1 117 GLU n 1 118 MET n 1 119 ASP n 1 120 PHE n 1 121 ARG n 1 122 SER n 1 123 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX4T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AKT1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P31749 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2UVM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31749 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GVF non-polymer . 'BENZENE-1,2,3,4-TETRAYL TETRAKIS[DIHYDROGEN (PHOSPHATE)]' ? 'C6 H10 O16 P4' 462.029 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2UVM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.96 _exptl_crystal.density_percent_sol 37 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.00 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '25-30% POLYETHYLENE GLYCOL 3000, 0.1 M SODIUM ACETATE TRIHYDRATE [PH 4.4-5.0], 0.2 M AMMONIUM ACETATE' # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2004-04-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.933 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2UVM _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15.000 _reflns.d_resolution_high 1.940 _reflns.number_obs 7781 _reflns.number_all ? _reflns.percent_possible_obs 91.7 _reflns.pdbx_Rmerge_I_obs 0.07000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.5000 _reflns.B_iso_Wilson_estimate 4.7 _reflns.pdbx_redundancy 2.900 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 2.01 _reflns_shell.percent_possible_all 94.6 _reflns_shell.Rmerge_I_obs 0.23000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.200 _reflns_shell.pdbx_redundancy 2.70 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2UVM _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7635 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1108126.64 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 14.98 _refine.ls_d_res_high 1.94 _refine.ls_percent_reflns_obs 90.4 _refine.ls_R_factor_obs 0.252 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.252 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error 0.012 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 6.5 _refine.ls_number_reflns_R_free 493 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 23.3 _refine.aniso_B[1][1] -0.30 _refine.aniso_B[2][2] 5.67 _refine.aniso_B[3][3] -5.37 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 3.42 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.368238 _refine.solvent_model_param_bsol 41.1029 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'C-TERMINUS DISORDERED. SOME DISORDERED RESIDUES WERE MODELLED AS ALA.' _refine.pdbx_starting_model 'PDB ENTRY 1H10' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2UVM _refine_analyze.Luzzati_coordinate_error_obs 0.26 _refine_analyze.Luzzati_sigma_a_obs 0.16 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.30 _refine_analyze.Luzzati_sigma_a_free 0.28 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 929 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 1009 _refine_hist.d_res_high 1.94 _refine_hist.d_res_low 14.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 26.7 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.09 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.48 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.23 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.13 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.13 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.94 _refine_ls_shell.d_res_low 2.06 _refine_ls_shell.number_reflns_R_work 1169 _refine_ls_shell.R_factor_R_work 0.263 _refine_ls_shell.percent_reflns_obs 90.7 _refine_ls_shell.R_factor_R_free 0.332 _refine_ls_shell.R_factor_R_free_error 0.037 _refine_ls_shell.percent_reflns_R_free 6.3 _refine_ls_shell.number_reflns_R_free 79 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 BENZIP4.PAR BENZIP4.TOP 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 4 ION.PARAM ION.TOP # _struct.entry_id 2UVM _struct.title 'Structure of PKBalpha PH domain in complex with a novel inositol headgroup surrogate, benzene 1,2,3,4-tetrakisphosphate' _struct.pdbx_descriptor 'RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2UVM _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;TRANSFERASE, GLYCOGEN BIOSYNTHESIS, TRANSLATION REGULATION, SERINE/THREONINE-PROTEIN KINASE, PHOSPHOINOSITIDE, PROTEIN KINASE B, GLUCOSE METABOLISM, NUCLEAR PROTEIN, CELL SIGNALLING, PHOSPHORYLATION, NUCLEOTIDE-BINDING, GLYCOGEN METABOLISM, KINASE, CANCER, INOSITOL, APOPTOSIS, TRANSPORT, CARBOHYDRATE METABOLISM, PH DOMAIN, ATP-BINDING, SUGAR TRANSPORT ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? VAL A 4 ? MET A 1 VAL A 4 5 ? 4 HELX_P HELX_P2 2 ASP A 44 ? GLU A 49 ? ASP A 44 GLU A 49 1 ? 6 HELX_P HELX_P3 3 THR A 92 ? GLU A 114 ? THR A 92 GLU A 114 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C NA . NA ? ? ? 1_555 B GVF . OAU ? ? A NA 1117 A GVF 1116 1_555 ? ? ? ? ? ? ? 2.155 ? metalc2 metalc ? ? C NA . NA ? ? ? 1_555 B GVF . OAV ? ? A NA 1117 A GVF 1116 1_555 ? ? ? ? ? ? ? 2.294 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 67 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 67 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 68 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 68 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.20 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ASN A 53 ? SER A 56 ? ASN A 53 SER A 56 AA 2 THR A 34 ? TYR A 38 ? THR A 34 TYR A 38 AA 3 TRP A 22 ? LYS A 30 ? TRP A 22 LYS A 30 AA 4 ILE A 6 ? ARG A 15 ? ILE A 6 ARG A 15 AA 5 THR A 82 ? HIS A 89 ? THR A 82 HIS A 89 AA 6 THR A 72 ? GLN A 79 ? THR A 72 GLN A 79 AA 7 GLN A 61 ? THR A 65 ? GLN A 61 THR A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N PHE A 55 ? N PHE A 55 O PHE A 35 ? O PHE A 35 AA 2 3 N TYR A 38 ? N TYR A 38 O TYR A 26 ? O TYR A 26 AA 3 4 O LEU A 29 ? O LEU A 29 N VAL A 7 ? N VAL A 7 AA 4 5 N ARG A 15 ? N ARG A 15 O THR A 87 ? O THR A 87 AA 5 6 N PHE A 88 ? N PHE A 88 O PHE A 73 ? O PHE A 73 AA 6 7 N ARG A 76 ? N ARG A 76 O GLN A 61 ? O GLN A 61 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A1117' AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE GVF A1116' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 HIS A 13 ? HIS A 13 . ? 1_555 ? 2 AC1 3 GVF B . ? GVF A 1116 . ? 1_555 ? 3 AC1 3 HOH D . ? HOH A 2011 . ? 1_555 ? 4 AC2 15 MET A 1 ? MET A 1 . ? 1_555 ? 5 AC2 15 SER A 2 ? SER A 2 . ? 1_555 ? 6 AC2 15 HIS A 13 ? HIS A 13 . ? 1_555 ? 7 AC2 15 LYS A 14 ? LYS A 14 . ? 1_555 ? 8 AC2 15 GLY A 16 ? GLY A 16 . ? 1_555 ? 9 AC2 15 GLU A 17 ? GLU A 17 . ? 1_555 ? 10 AC2 15 TYR A 18 ? TYR A 18 . ? 1_555 ? 11 AC2 15 ARG A 23 ? ARG A 23 . ? 1_555 ? 12 AC2 15 ARG A 25 ? ARG A 25 . ? 1_555 ? 13 AC2 15 ASN A 53 ? ASN A 53 . ? 1_555 ? 14 AC2 15 PHE A 55 ? PHE A 55 . ? 1_555 ? 15 AC2 15 ARG A 69 ? ARG A 69 . ? 1_555 ? 16 AC2 15 ARG A 86 ? ARG A 86 . ? 1_555 ? 17 AC2 15 NA C . ? NA A 1117 . ? 1_555 ? 18 AC2 15 HOH D . ? HOH A 2053 . ? 1_555 ? # _database_PDB_matrix.entry_id 2UVM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2UVM _atom_sites.fract_transf_matrix[1][1] 0.012495 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005112 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029377 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024040 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NA O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 THR 101 101 101 THR THR A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 GLU 117 117 ? ? ? A . n A 1 118 MET 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 PHE 120 120 ? ? ? A . n A 1 121 ARG 121 121 ? ? ? A . n A 1 122 SER 122 122 ? ? ? A . n A 1 123 GLY 123 123 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GVF 1 1116 1116 GVF GVF A . C 3 NA 1 1117 1117 NA NA A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OAU _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id B _pdbx_struct_conn_angle.ptnr1_label_comp_id GVF _pdbx_struct_conn_angle.ptnr1_label_seq_id . _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GVF _pdbx_struct_conn_angle.ptnr1_auth_seq_id 1116 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id C _pdbx_struct_conn_angle.ptnr2_label_comp_id NA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 1117 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id OAV _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id B _pdbx_struct_conn_angle.ptnr3_label_comp_id GVF _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id GVF _pdbx_struct_conn_angle.ptnr3_auth_seq_id 1116 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 92.2 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-17 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 CNS phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 80 ? ? 76.67 -95.63 2 1 GLU A 114 ? ? -61.33 0.65 3 1 GLU A 115 ? ? -0.65 -106.06 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2007 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.28 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 3 ? CG ? A ASP 3 CG 2 1 Y 1 A ASP 3 ? OD1 ? A ASP 3 OD1 3 1 Y 1 A ASP 3 ? OD2 ? A ASP 3 OD2 4 1 Y 1 A GLU 17 ? CG ? A GLU 17 CG 5 1 Y 1 A GLU 17 ? CD ? A GLU 17 CD 6 1 Y 1 A GLU 17 ? OE1 ? A GLU 17 OE1 7 1 Y 1 A GLU 17 ? OE2 ? A GLU 17 OE2 8 1 Y 1 A LYS 39 ? CB ? A LYS 39 CB 9 1 Y 1 A LYS 39 ? CG ? A LYS 39 CG 10 1 Y 1 A LYS 39 ? CD ? A LYS 39 CD 11 1 Y 1 A LYS 39 ? CE ? A LYS 39 CE 12 1 Y 1 A LYS 39 ? NZ ? A LYS 39 NZ 13 1 Y 1 A GLN 43 ? CG ? A GLN 43 CG 14 1 Y 1 A GLN 43 ? CD ? A GLN 43 CD 15 1 Y 1 A GLN 43 ? OE1 ? A GLN 43 OE1 16 1 Y 1 A GLN 43 ? NE2 ? A GLN 43 NE2 17 1 Y 1 A ARG 76 ? CG ? A ARG 76 CG 18 1 Y 1 A ARG 76 ? CD ? A ARG 76 CD 19 1 Y 1 A ARG 76 ? NE ? A ARG 76 NE 20 1 Y 1 A ARG 76 ? CZ ? A ARG 76 CZ 21 1 Y 1 A ARG 76 ? NH1 ? A ARG 76 NH1 22 1 Y 1 A ARG 76 ? NH2 ? A ARG 76 NH2 23 1 Y 1 A LYS 111 ? CG ? A LYS 111 CG 24 1 Y 1 A LYS 111 ? CD ? A LYS 111 CD 25 1 Y 1 A LYS 111 ? CE ? A LYS 111 CE 26 1 Y 1 A LYS 111 ? NZ ? A LYS 111 NZ 27 1 Y 1 A LYS 112 ? CG ? A LYS 112 CG 28 1 Y 1 A LYS 112 ? CD ? A LYS 112 CD 29 1 Y 1 A LYS 112 ? CE ? A LYS 112 CE 30 1 Y 1 A LYS 112 ? NZ ? A LYS 112 NZ 31 1 Y 1 A GLU 114 ? CG ? A GLU 114 CG 32 1 Y 1 A GLU 114 ? CD ? A GLU 114 CD 33 1 Y 1 A GLU 114 ? OE1 ? A GLU 114 OE1 34 1 Y 1 A GLU 114 ? OE2 ? A GLU 114 OE2 35 1 Y 1 A GLU 115 ? CG ? A GLU 115 CG 36 1 Y 1 A GLU 115 ? CD ? A GLU 115 CD 37 1 Y 1 A GLU 115 ? OE1 ? A GLU 115 OE1 38 1 Y 1 A GLU 115 ? OE2 ? A GLU 115 OE2 39 1 Y 1 A GLU 116 ? CA ? A GLU 116 CA 40 1 Y 1 A GLU 116 ? C ? A GLU 116 C 41 1 Y 1 A GLU 116 ? O ? A GLU 116 O 42 1 Y 1 A GLU 116 ? CB ? A GLU 116 CB 43 1 Y 1 A GLU 116 ? CG ? A GLU 116 CG 44 1 Y 1 A GLU 116 ? CD ? A GLU 116 CD 45 1 Y 1 A GLU 116 ? OE1 ? A GLU 116 OE1 46 1 Y 1 A GLU 116 ? OE2 ? A GLU 116 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLU 117 ? A GLU 117 2 1 Y 1 A MET 118 ? A MET 118 3 1 Y 1 A ASP 119 ? A ASP 119 4 1 Y 1 A PHE 120 ? A PHE 120 5 1 Y 1 A ARG 121 ? A ARG 121 6 1 Y 1 A SER 122 ? A SER 122 7 1 Y 1 A GLY 123 ? A GLY 123 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'BENZENE-1,2,3,4-TETRAYL TETRAKIS[DIHYDROGEN (PHOSPHATE)]' GVF 3 'SODIUM ION' NA 4 water HOH #