data_2V7F # _entry.id 2V7F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2V7F PDBE EBI-33306 WWPDB D_1290033306 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2V7F _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2007-07-30 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gregory, L.A.' 1 'Aguissa-Toure, A.H.' 2 'Pinaud, N.' 3 'Legrand, P.' 4 'Gleizes, P.E.' 5 'Fribourg, S.' 6 # _citation.id primary _citation.title 'Molecular Basis of Diamond Blackfan Anemia: Structure and Function Analysis of Rps19.' _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_volume 35 _citation.page_first 5913 _citation.page_last ? _citation.year 2007 _citation.journal_id_ASTM NARHAD _citation.country UK _citation.journal_id_ISSN 0305-1048 _citation.journal_id_CSD 0389 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17726054 _citation.pdbx_database_id_DOI 10.1093/NAR/GKM626 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Gregory, L.A.' 1 primary 'Aguissa-Toure, A.H.' 2 primary 'Pinaud, N.' 3 primary 'Legrand, P.' 4 primary 'Gleizes, P.E.' 5 primary 'Fribourg, S.' 6 # _cell.entry_id 2V7F _cell.length_a 32.700 _cell.length_b 57.430 _cell.length_c 80.200 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2V7F _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'RPS19E SSU RIBOSOMAL PROTEIN S19E' 17422.250 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 178 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name RPS19 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGR KNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY ; _entity_poly.pdbx_seq_one_letter_code_can ;MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWWYYRVASILRRVYLDGPVGIERLRTYYGGR KNRGHAPERFYKAGGSIIRKALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 VAL n 1 5 TYR n 1 6 ASP n 1 7 VAL n 1 8 PRO n 1 9 GLY n 1 10 ASP n 1 11 LEU n 1 12 LEU n 1 13 VAL n 1 14 GLU n 1 15 ARG n 1 16 VAL n 1 17 ALA n 1 18 GLN n 1 19 ARG n 1 20 LEU n 1 21 LYS n 1 22 GLU n 1 23 ILE n 1 24 PRO n 1 25 GLU n 1 26 ILE n 1 27 LYS n 1 28 PRO n 1 29 PRO n 1 30 GLU n 1 31 TRP n 1 32 ALA n 1 33 PRO n 1 34 PHE n 1 35 VAL n 1 36 LYS n 1 37 THR n 1 38 GLY n 1 39 ARG n 1 40 HIS n 1 41 LYS n 1 42 GLU n 1 43 ARG n 1 44 LEU n 1 45 PRO n 1 46 GLU n 1 47 GLN n 1 48 GLU n 1 49 ASP n 1 50 TRP n 1 51 TRP n 1 52 TYR n 1 53 TYR n 1 54 ARG n 1 55 VAL n 1 56 ALA n 1 57 SER n 1 58 ILE n 1 59 LEU n 1 60 ARG n 1 61 ARG n 1 62 VAL n 1 63 TYR n 1 64 LEU n 1 65 ASP n 1 66 GLY n 1 67 PRO n 1 68 VAL n 1 69 GLY n 1 70 ILE n 1 71 GLU n 1 72 ARG n 1 73 LEU n 1 74 ARG n 1 75 THR n 1 76 TYR n 1 77 TYR n 1 78 GLY n 1 79 GLY n 1 80 ARG n 1 81 LYS n 1 82 ASN n 1 83 ARG n 1 84 GLY n 1 85 HIS n 1 86 ALA n 1 87 PRO n 1 88 GLU n 1 89 ARG n 1 90 PHE n 1 91 TYR n 1 92 LYS n 1 93 ALA n 1 94 GLY n 1 95 GLY n 1 96 SER n 1 97 ILE n 1 98 ILE n 1 99 ARG n 1 100 LYS n 1 101 ALA n 1 102 LEU n 1 103 GLN n 1 104 GLN n 1 105 LEU n 1 106 GLU n 1 107 ALA n 1 108 ALA n 1 109 GLY n 1 110 PHE n 1 111 VAL n 1 112 GLU n 1 113 LYS n 1 114 VAL n 1 115 PRO n 1 116 GLY n 1 117 LYS n 1 118 GLY n 1 119 ARG n 1 120 VAL n 1 121 ILE n 1 122 THR n 1 123 PRO n 1 124 LYS n 1 125 GLY n 1 126 ARG n 1 127 SER n 1 128 PHE n 1 129 LEU n 1 130 ASP n 1 131 LYS n 1 132 ILE n 1 133 ALA n 1 134 THR n 1 135 GLU n 1 136 LEU n 1 137 LYS n 1 138 LYS n 1 139 GLU n 1 140 LEU n 1 141 GLU n 1 142 GLU n 1 143 ILE n 1 144 ILE n 1 145 PRO n 1 146 GLU n 1 147 LEU n 1 148 LYS n 1 149 LYS n 1 150 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PYROCOCCUS ABYSSI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 29292 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) ROSETTA' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PET-15B MODIFIED' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9V0G8_PYRAB _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9V0G8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2V7F _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9V0G8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2V7F _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.5 _exptl_crystal.density_percent_sol 48.0 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '30% - 36% PEG 2000MME TRIS-HCL 100MM PH 6.8 - 7.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.984 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.984 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2V7F _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 28.00 _reflns.d_resolution_high 1.15 _reflns.number_obs 49876 _reflns.number_all ? _reflns.percent_possible_obs 91.5 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 22.25 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.5 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.15 _reflns_shell.d_res_low 1.25 _reflns_shell.percent_possible_all 72.3 _reflns_shell.Rmerge_I_obs 0.21 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.12 _reflns_shell.pdbx_redundancy 3.3 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2V7F _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 49720 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.57 _refine.ls_d_res_high 1.15 _refine.ls_percent_reflns_obs 96.0 _refine.ls_R_factor_obs 0.138 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.137 _refine.ls_R_factor_R_free 0.155 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 2612 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.976 _refine.correlation_coeff_Fo_to_Fc_free 0.969 _refine.B_iso_mean 15.62 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.032 _refine.pdbx_overall_ESU_R_Free 0.031 _refine.overall_SU_ML 0.016 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.739 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1128 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 178 _refine_hist.number_atoms_total 1307 _refine_hist.d_res_high 1.15 _refine_hist.d_res_low 19.57 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.019 0.022 ? 1270 'X-RAY DIFFRACTION' ? r_bond_other_d 0.000 0.020 ? 1154 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.818 1.993 ? 1721 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.939 3.000 ? 2701 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.106 5.000 ? 153 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.364 22.333 ? 60 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.518 15.000 ? 246 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 13.451 15.000 ? 14 'X-RAY DIFFRACTION' ? r_chiral_restr 0.127 0.200 ? 181 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.012 0.020 ? 1363 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.000 0.020 ? 264 'X-RAY DIFFRACTION' ? r_nbd_refined 0.258 0.200 ? 273 'X-RAY DIFFRACTION' ? r_nbd_other 0.246 0.200 ? 1190 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.206 0.200 ? 623 'X-RAY DIFFRACTION' ? r_nbtor_other 0.097 0.200 ? 688 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.279 0.200 ? 100 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.356 0.200 ? 18 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.354 0.200 ? 91 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.175 0.200 ? 34 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.853 1.500 ? 752 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.540 2.000 ? 1205 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.213 3.000 ? 595 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 4.245 4.500 ? 510 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.15 _refine_ls_shell.d_res_low 1.18 _refine_ls_shell.number_reflns_R_work 3195 _refine_ls_shell.R_factor_R_work 0.1590 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2040 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 167 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2V7F _struct.title 'Structure of P. abyssi RPS19 protein' _struct.pdbx_descriptor 'RPS19E SSU RIBOSOMAL PROTEIN S19E' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2V7F _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' _struct_keywords.text 'DIAMOND BLACKFAN ANEMIA SMALL RIBOSOMAL SUBUNIT, RIBOSOMAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 3 ? VAL A 7 ? THR A 3 VAL A 7 5 ? 5 HELX_P HELX_P2 2 PRO A 8 ? LYS A 21 ? PRO A 8 LYS A 21 1 ? 14 HELX_P HELX_P3 3 TRP A 31 ? VAL A 35 ? TRP A 31 VAL A 35 5 ? 5 HELX_P HELX_P4 4 LEU A 44 ? ASP A 49 ? LEU A 44 ASP A 49 1 ? 6 HELX_P HELX_P5 5 ASP A 49 ? GLY A 66 ? ASP A 49 GLY A 66 1 ? 18 HELX_P HELX_P6 6 GLY A 69 ? GLY A 78 ? GLY A 69 GLY A 78 1 ? 10 HELX_P HELX_P7 7 LYS A 92 ? ALA A 108 ? LYS A 92 ALA A 108 1 ? 17 HELX_P HELX_P8 8 THR A 122 ? LEU A 147 ? THR A 122 LEU A 147 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 66 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 66 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 67 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 67 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.87 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 111 ? VAL A 114 ? VAL A 111 VAL A 114 AA 2 GLY A 118 ? ILE A 121 ? GLY A 118 ILE A 121 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 114 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 114 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 118 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 118 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE CL A1151' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 PRO A 29 ? PRO A 29 . ? 1_555 ? 2 AC1 4 GLU A 30 ? GLU A 30 . ? 1_555 ? 3 AC1 4 TRP A 31 ? TRP A 31 . ? 1_555 ? 4 AC1 4 ALA A 32 ? ALA A 32 . ? 1_555 ? # _database_PDB_matrix.entry_id 2V7F _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2V7F _atom_sites.fract_transf_matrix[1][1] 0.030581 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017413 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012469 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 GLY 38 38 ? ? ? A . n A 1 39 ARG 39 39 ? ? ? A . n A 1 40 HIS 40 40 ? ? ? A . n A 1 41 LYS 41 41 ? ? ? A . n A 1 42 GLU 42 42 ? ? ? A . n A 1 43 ARG 43 43 ? ? ? A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 TRP 51 51 51 TRP TRP A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ARG 80 80 ? ? ? A . n A 1 81 LYS 81 81 ? ? ? A . n A 1 82 ASN 82 82 ? ? ? A . n A 1 83 ARG 83 83 ? ? ? A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 TYR 150 150 150 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 1151 1151 CL CL A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . C 3 HOH 62 2062 2062 HOH HOH A . C 3 HOH 63 2063 2063 HOH HOH A . C 3 HOH 64 2064 2064 HOH HOH A . C 3 HOH 65 2065 2065 HOH HOH A . C 3 HOH 66 2066 2066 HOH HOH A . C 3 HOH 67 2067 2067 HOH HOH A . C 3 HOH 68 2068 2068 HOH HOH A . C 3 HOH 69 2069 2069 HOH HOH A . C 3 HOH 70 2070 2070 HOH HOH A . C 3 HOH 71 2071 2071 HOH HOH A . C 3 HOH 72 2072 2072 HOH HOH A . C 3 HOH 73 2073 2073 HOH HOH A . C 3 HOH 74 2074 2074 HOH HOH A . C 3 HOH 75 2075 2075 HOH HOH A . C 3 HOH 76 2076 2076 HOH HOH A . C 3 HOH 77 2077 2077 HOH HOH A . C 3 HOH 78 2078 2078 HOH HOH A . C 3 HOH 79 2079 2079 HOH HOH A . C 3 HOH 80 2080 2080 HOH HOH A . C 3 HOH 81 2081 2081 HOH HOH A . C 3 HOH 82 2082 2082 HOH HOH A . C 3 HOH 83 2083 2083 HOH HOH A . C 3 HOH 84 2084 2084 HOH HOH A . C 3 HOH 85 2085 2085 HOH HOH A . C 3 HOH 86 2086 2086 HOH HOH A . C 3 HOH 87 2087 2087 HOH HOH A . C 3 HOH 88 2088 2088 HOH HOH A . C 3 HOH 89 2089 2089 HOH HOH A . C 3 HOH 90 2090 2090 HOH HOH A . C 3 HOH 91 2091 2091 HOH HOH A . C 3 HOH 92 2092 2092 HOH HOH A . C 3 HOH 93 2093 2093 HOH HOH A . C 3 HOH 94 2094 2094 HOH HOH A . C 3 HOH 95 2095 2095 HOH HOH A . C 3 HOH 96 2096 2096 HOH HOH A . C 3 HOH 97 2097 2097 HOH HOH A . C 3 HOH 98 2098 2098 HOH HOH A . C 3 HOH 99 2099 2099 HOH HOH A . C 3 HOH 100 2100 2100 HOH HOH A . C 3 HOH 101 2101 2101 HOH HOH A . C 3 HOH 102 2102 2102 HOH HOH A . C 3 HOH 103 2103 2103 HOH HOH A . C 3 HOH 104 2104 2104 HOH HOH A . C 3 HOH 105 2105 2105 HOH HOH A . C 3 HOH 106 2106 2106 HOH HOH A . C 3 HOH 107 2107 2107 HOH HOH A . C 3 HOH 108 2108 2108 HOH HOH A . C 3 HOH 109 2109 2109 HOH HOH A . C 3 HOH 110 2110 2110 HOH HOH A . C 3 HOH 111 2111 2111 HOH HOH A . C 3 HOH 112 2112 2112 HOH HOH A . C 3 HOH 113 2113 2113 HOH HOH A . C 3 HOH 114 2114 2114 HOH HOH A . C 3 HOH 115 2115 2115 HOH HOH A . C 3 HOH 116 2116 2116 HOH HOH A . C 3 HOH 117 2117 2117 HOH HOH A . C 3 HOH 118 2118 2118 HOH HOH A . C 3 HOH 119 2119 2119 HOH HOH A . C 3 HOH 120 2120 2120 HOH HOH A . C 3 HOH 121 2121 2121 HOH HOH A . C 3 HOH 122 2122 2122 HOH HOH A . C 3 HOH 123 2123 2123 HOH HOH A . C 3 HOH 124 2124 2124 HOH HOH A . C 3 HOH 125 2125 2125 HOH HOH A . C 3 HOH 126 2126 2126 HOH HOH A . C 3 HOH 127 2127 2127 HOH HOH A . C 3 HOH 128 2128 2128 HOH HOH A . C 3 HOH 129 2129 2129 HOH HOH A . C 3 HOH 130 2130 2130 HOH HOH A . C 3 HOH 131 2131 2131 HOH HOH A . C 3 HOH 132 2132 2132 HOH HOH A . C 3 HOH 133 2133 2133 HOH HOH A . C 3 HOH 134 2134 2134 HOH HOH A . C 3 HOH 135 2135 2135 HOH HOH A . C 3 HOH 136 2136 2136 HOH HOH A . C 3 HOH 137 2137 2137 HOH HOH A . C 3 HOH 138 2138 2138 HOH HOH A . C 3 HOH 139 2139 2139 HOH HOH A . C 3 HOH 140 2140 2140 HOH HOH A . C 3 HOH 141 2141 2141 HOH HOH A . C 3 HOH 142 2142 2142 HOH HOH A . C 3 HOH 143 2143 2143 HOH HOH A . C 3 HOH 144 2144 2144 HOH HOH A . C 3 HOH 145 2145 2145 HOH HOH A . C 3 HOH 146 2146 2146 HOH HOH A . C 3 HOH 147 2147 2147 HOH HOH A . C 3 HOH 148 2148 2148 HOH HOH A . C 3 HOH 149 2149 2149 HOH HOH A . C 3 HOH 150 2150 2150 HOH HOH A . C 3 HOH 151 2151 2151 HOH HOH A . C 3 HOH 152 2152 2152 HOH HOH A . C 3 HOH 153 2153 2153 HOH HOH A . C 3 HOH 154 2154 2154 HOH HOH A . C 3 HOH 155 2155 2155 HOH HOH A . C 3 HOH 156 2156 2156 HOH HOH A . C 3 HOH 157 2157 2157 HOH HOH A . C 3 HOH 158 2158 2158 HOH HOH A . C 3 HOH 159 2159 2159 HOH HOH A . C 3 HOH 160 2160 2160 HOH HOH A . C 3 HOH 161 2161 2161 HOH HOH A . C 3 HOH 162 2162 2162 HOH HOH A . C 3 HOH 163 2163 2163 HOH HOH A . C 3 HOH 164 2164 2164 HOH HOH A . C 3 HOH 165 2165 2165 HOH HOH A . C 3 HOH 166 2166 2166 HOH HOH A . C 3 HOH 167 2167 2167 HOH HOH A . C 3 HOH 168 2168 2168 HOH HOH A . C 3 HOH 169 2169 2169 HOH HOH A . C 3 HOH 170 2170 2170 HOH HOH A . C 3 HOH 171 2171 2171 HOH HOH A . C 3 HOH 172 2172 2172 HOH HOH A . C 3 HOH 173 2173 2173 HOH HOH A . C 3 HOH 174 2174 2174 HOH HOH A . C 3 HOH 175 2175 2175 HOH HOH A . C 3 HOH 176 2176 2176 HOH HOH A . C 3 HOH 177 2177 2177 HOH HOH A . C 3 HOH 178 2178 2178 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-11 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 27.8840 40.3040 13.9110 -0.0561 -0.0667 -0.0601 0.0073 0.0070 0.0027 0.2975 0.4480 0.3290 0.0087 -0.0078 -0.0733 0.0294 0.0049 0.0343 -0.0080 -0.0269 0.0013 0.0055 -0.0208 -0.0025 'X-RAY DIFFRACTION' 2 ? refined 27.9600 38.1680 11.6340 0.0523 0.0645 0.0452 0.0012 0.0169 0.0046 0.3226 0.6623 0.3470 -0.0286 0.0479 -0.0318 0.0067 0.0420 0.0500 -0.0418 -0.0215 0.0131 -0.0156 -0.0180 0.0148 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 1 ? ? A 200 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 2001 ? ? A 2178 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 XDS 'data reduction' . ? 2 XSCALE 'data scaling' . ? 3 SHARP phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 30 ? ? O A HOH 2048 ? ? 1.88 2 1 N A GLY 84 ? ? O A HOH 2103 ? ? 2.05 3 1 NH2 A ARG 99 ? ? O A HOH 2119 ? ? 2.14 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLU 112 ? ? 1_555 NZ A LYS 131 ? ? 4_465 0.56 2 1 CD A GLU 112 ? ? 1_555 NZ A LYS 131 ? ? 4_465 1.55 3 1 OE1 A GLU 112 ? ? 1_555 CE A LYS 131 ? ? 4_465 2.00 4 1 O A HOH 2102 ? ? 1_555 O A HOH 2166 ? ? 3_755 2.13 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CE _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 LYS _pdbx_validate_rmsd_bond.auth_seq_id_1 131 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 NZ _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 LYS _pdbx_validate_rmsd_bond.auth_seq_id_2 131 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.683 _pdbx_validate_rmsd_bond.bond_target_value 1.486 _pdbx_validate_rmsd_bond.bond_deviation 0.197 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.025 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 99 ? ? CZ A ARG 99 ? ? NH1 A ARG 99 ? ? 125.65 120.30 5.35 0.50 N 2 1 NE A ARG 99 ? ? CZ A ARG 99 ? ? NH2 A ARG 99 ? ? 114.29 120.30 -6.01 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 86 ? ? -157.78 73.59 2 1 LYS A 92 ? ? -86.53 -159.66 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 44 ? CG ? A LEU 44 CG 2 1 Y 1 A LEU 44 ? CD1 ? A LEU 44 CD1 3 1 Y 1 A LEU 44 ? CD2 ? A LEU 44 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 38 ? A GLY 38 3 1 Y 1 A ARG 39 ? A ARG 39 4 1 Y 1 A HIS 40 ? A HIS 40 5 1 Y 1 A LYS 41 ? A LYS 41 6 1 Y 1 A GLU 42 ? A GLU 42 7 1 Y 1 A ARG 43 ? A ARG 43 8 1 Y 1 A ARG 80 ? A ARG 80 9 1 Y 1 A LYS 81 ? A LYS 81 10 1 Y 1 A ASN 82 ? A ASN 82 11 1 Y 1 A ARG 83 ? A ARG 83 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH #