data_2V82 # _entry.id 2V82 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2V82 PDBE EBI-33361 WWPDB D_1290033361 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2J6Q unspecified 'THE NATIVE STRUCTURE OF KDPGAL ALDOLASE' PDB 2J6N unspecified 'THE NATIVE STRUCTURE OF KDPGAL ALDOLASE' PDB 2V81 unspecified 'NATIVE KDPGAL STRUCTURE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2V82 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2007-08-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Naismith, J.H.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Characterization and crystal structure of Escherichia coli KDPGal aldolase.' _citation.journal_abbrev 'Bioorg. Med. Chem.' _citation.journal_volume 16 _citation.page_first 710 _citation.page_last 720 _citation.year 2008 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 1464-3391 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17981470 _citation.pdbx_database_id_DOI 10.1016/j.bmc.2007.10.043 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Walters, M.J.' 1 primary 'Srikannathasan, V.' 2 primary 'McEwan, A.R.' 3 primary 'Naismith, J.H.' 4 primary 'Fierke, C.A.' 5 primary 'Toone, E.J.' 6 # _cell.entry_id 2V82 _cell.length_a 104.600 _cell.length_b 104.600 _cell.length_c 74.210 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2V82 _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '2-DEHYDRO-3-DEOXY-6-PHOSPHOGALACTONATE ALDOLASE' 22489.225 1 4.1.2.21 ? ? ? 2 non-polymer syn 2-KETO-DEOXY-GALACTOSE 258.120 1 ? ? ? ? 3 water nat water 18.015 61 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name '6-PHOSPHO-2-DEHYDRO-3-DEOXYGALACTONATE ALDOLASE, 2-OXO-3-DEOXYGALACTONATE 6-PHOSPHATE ALDOLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)QWQTKLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPQWEQSIPAIVDAYGDKALIGAGTVLKPEQVDAL AR(MSE)GCQLIVTPNIHSEVIRRAVGYG(MSE)TVCPGCATATEAFTALEAGAQALKIFPSSAFGPQYIKALKAVLPSD IAVFAVGGVTPENLAQWIDAGCAGAGLGSDLYRAGQSVERTAQQAAAFVKAYREAVQLHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQWQTKLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPQWEQSIPAIVDAYGDKALIGAGTVLKPEQVDALARMG CQLIVTPNIHSEVIRRAVGYGMTVCPGCATATEAFTALEAGAQALKIFPSSAFGPQYIKALKAVLPSDIAVFAVGGVTPE NLAQWIDAGCAGAGLGSDLYRAGQSVERTAQQAAAFVKAYREAVQLHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLN n 1 3 TRP n 1 4 GLN n 1 5 THR n 1 6 LYS n 1 7 LEU n 1 8 PRO n 1 9 LEU n 1 10 ILE n 1 11 ALA n 1 12 ILE n 1 13 LEU n 1 14 ARG n 1 15 GLY n 1 16 ILE n 1 17 THR n 1 18 PRO n 1 19 ASP n 1 20 GLU n 1 21 ALA n 1 22 LEU n 1 23 ALA n 1 24 HIS n 1 25 VAL n 1 26 GLY n 1 27 ALA n 1 28 VAL n 1 29 ILE n 1 30 ASP n 1 31 ALA n 1 32 GLY n 1 33 PHE n 1 34 ASP n 1 35 ALA n 1 36 VAL n 1 37 GLU n 1 38 ILE n 1 39 PRO n 1 40 LEU n 1 41 ASN n 1 42 SER n 1 43 PRO n 1 44 GLN n 1 45 TRP n 1 46 GLU n 1 47 GLN n 1 48 SER n 1 49 ILE n 1 50 PRO n 1 51 ALA n 1 52 ILE n 1 53 VAL n 1 54 ASP n 1 55 ALA n 1 56 TYR n 1 57 GLY n 1 58 ASP n 1 59 LYS n 1 60 ALA n 1 61 LEU n 1 62 ILE n 1 63 GLY n 1 64 ALA n 1 65 GLY n 1 66 THR n 1 67 VAL n 1 68 LEU n 1 69 LYS n 1 70 PRO n 1 71 GLU n 1 72 GLN n 1 73 VAL n 1 74 ASP n 1 75 ALA n 1 76 LEU n 1 77 ALA n 1 78 ARG n 1 79 MSE n 1 80 GLY n 1 81 CYS n 1 82 GLN n 1 83 LEU n 1 84 ILE n 1 85 VAL n 1 86 THR n 1 87 PRO n 1 88 ASN n 1 89 ILE n 1 90 HIS n 1 91 SER n 1 92 GLU n 1 93 VAL n 1 94 ILE n 1 95 ARG n 1 96 ARG n 1 97 ALA n 1 98 VAL n 1 99 GLY n 1 100 TYR n 1 101 GLY n 1 102 MSE n 1 103 THR n 1 104 VAL n 1 105 CYS n 1 106 PRO n 1 107 GLY n 1 108 CYS n 1 109 ALA n 1 110 THR n 1 111 ALA n 1 112 THR n 1 113 GLU n 1 114 ALA n 1 115 PHE n 1 116 THR n 1 117 ALA n 1 118 LEU n 1 119 GLU n 1 120 ALA n 1 121 GLY n 1 122 ALA n 1 123 GLN n 1 124 ALA n 1 125 LEU n 1 126 LYS n 1 127 ILE n 1 128 PHE n 1 129 PRO n 1 130 SER n 1 131 SER n 1 132 ALA n 1 133 PHE n 1 134 GLY n 1 135 PRO n 1 136 GLN n 1 137 TYR n 1 138 ILE n 1 139 LYS n 1 140 ALA n 1 141 LEU n 1 142 LYS n 1 143 ALA n 1 144 VAL n 1 145 LEU n 1 146 PRO n 1 147 SER n 1 148 ASP n 1 149 ILE n 1 150 ALA n 1 151 VAL n 1 152 PHE n 1 153 ALA n 1 154 VAL n 1 155 GLY n 1 156 GLY n 1 157 VAL n 1 158 THR n 1 159 PRO n 1 160 GLU n 1 161 ASN n 1 162 LEU n 1 163 ALA n 1 164 GLN n 1 165 TRP n 1 166 ILE n 1 167 ASP n 1 168 ALA n 1 169 GLY n 1 170 CYS n 1 171 ALA n 1 172 GLY n 1 173 ALA n 1 174 GLY n 1 175 LEU n 1 176 GLY n 1 177 SER n 1 178 ASP n 1 179 LEU n 1 180 TYR n 1 181 ARG n 1 182 ALA n 1 183 GLY n 1 184 GLN n 1 185 SER n 1 186 VAL n 1 187 GLU n 1 188 ARG n 1 189 THR n 1 190 ALA n 1 191 GLN n 1 192 GLN n 1 193 ALA n 1 194 ALA n 1 195 ALA n 1 196 PHE n 1 197 VAL n 1 198 LYS n 1 199 ALA n 1 200 TYR n 1 201 ARG n 1 202 GLU n 1 203 ALA n 1 204 VAL n 1 205 GLN n 1 206 LEU n 1 207 HIS n 1 208 HIS n 1 209 HIS n 1 210 HIS n 1 211 HIS n 1 212 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP DGOA_ECOLI 1 ? ? Q6BF16 ? 2 PDB 2V82 1 ? ? 2V82 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2V82 A 1 ? 205 ? Q6BF16 1 ? 205 ? 1 205 2 2 2V82 A 206 ? 212 ? 2V82 206 ? 212 ? 206 212 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KDP non-polymer . 2-KETO-DEOXY-GALACTOSE ? 'C6 H11 O9 P' 258.120 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2V82 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.52 _exptl_crystal.density_percent_sol 64.81 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE BM14' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline BM14 _diffrn_source.pdbx_wavelength 0.979 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2V82 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 2.10 _reflns.number_obs 17654 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 20.00 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.2 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.20 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.36 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.00 _reflns_shell.pdbx_redundancy 4.0 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2V82 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.ls_number_reflns_obs 16789 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 52.27 _refine.ls_d_res_high 2.10 _refine.ls_percent_reflns_obs 99.9 _refine.ls_R_factor_obs 0.216 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.215 _refine.ls_R_factor_R_free 0.247 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.900 _refine.ls_number_reflns_R_free 863 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.926 _refine.correlation_coeff_Fo_to_Fc_free 0.902 _refine.B_iso_mean 35.49 _refine.aniso_B[1][1] 0.31000 _refine.aniso_B[2][2] 0.31000 _refine.aniso_B[3][3] -0.47000 _refine.aniso_B[1][2] 0.16000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model 'PDB ENTRY 2V81' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.179 _refine.pdbx_overall_ESU_R_Free 0.162 _refine.overall_SU_ML 0.125 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 9.321 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1505 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 1581 _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 52.27 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.022 ? 1554 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.265 1.974 ? 2125 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.618 5.000 ? 206 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.800 24.828 ? 58 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.887 15.000 ? 233 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 10.925 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.083 0.200 ? 249 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 1180 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.217 0.200 ? 778 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.303 0.200 ? 1084 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.137 0.200 ? 77 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.184 0.200 ? 30 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.145 0.200 ? 12 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.763 1.500 ? 1042 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 0.998 2.000 ? 1630 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.602 3.000 ? 581 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 2.463 4.500 ? 494 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.10 _refine_ls_shell.d_res_low 2.15 _refine_ls_shell.number_reflns_R_work 1226 _refine_ls_shell.R_factor_R_work 0.2440 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2540 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 76 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2V82 _struct.title 'KDPGal complexed to KDPGal' _struct.pdbx_descriptor '2-DEHYDRO-3-DEOXY-6-PHOSPHOGALACTONATE ALDOLASE (E.C.4.1.2.21)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2V82 _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'LYASE, KDPGAL, ALDOLASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 17 ? GLY A 32 ? THR A 17 GLY A 32 1 ? 16 HELX_P HELX_P2 2 GLN A 44 ? GLY A 57 ? GLN A 44 GLY A 57 1 ? 14 HELX_P HELX_P3 3 LYS A 69 ? MSE A 79 ? LYS A 69 MSE A 79 1 ? 11 HELX_P HELX_P4 4 HIS A 90 ? TYR A 100 ? HIS A 90 TYR A 100 1 ? 11 HELX_P HELX_P5 5 THR A 110 ? ALA A 120 ? THR A 110 ALA A 120 1 ? 11 HELX_P HELX_P6 6 PRO A 129 ? GLY A 134 ? PRO A 129 GLY A 134 1 ? 6 HELX_P HELX_P7 7 GLY A 134 ? ALA A 143 ? GLY A 134 ALA A 143 1 ? 10 HELX_P HELX_P8 8 ASN A 161 ? GLY A 169 ? ASN A 161 GLY A 169 1 ? 9 HELX_P HELX_P9 9 SER A 185 ? LEU A 206 ? SER A 185 LEU A 206 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ARG 78 C ? ? ? 1_555 A MSE 79 N ? ? A ARG 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A MSE 79 C ? ? ? 1_555 A GLY 80 N ? ? A MSE 79 A GLY 80 1_555 ? ? ? ? ? ? ? 1.336 ? covale3 covale ? ? A GLY 101 C ? ? ? 1_555 A MSE 102 N ? ? A GLY 101 A MSE 102 1_555 ? ? ? ? ? ? ? 1.332 ? covale4 covale ? ? A MSE 102 C ? ? ? 1_555 A THR 103 N ? ? A MSE 102 A THR 103 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale ? ? A LYS 126 NZ ? ? ? 1_555 B KDP . CAM ? ? A LYS 126 A KDP 1207 1_555 ? ? ? ? ? ? ? 1.317 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 128 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 128 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 129 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 129 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -13.67 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? parallel AA 5 6 ? parallel AA 6 7 ? parallel AA 7 8 ? parallel AA 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 103 ? CYS A 105 ? THR A 103 CYS A 105 AA 2 LEU A 83 ? VAL A 85 ? LEU A 83 VAL A 85 AA 3 LEU A 61 ? GLY A 65 ? LEU A 61 GLY A 65 AA 4 ALA A 35 ? PRO A 39 ? ALA A 35 PRO A 39 AA 5 LEU A 9 ? ILE A 12 ? LEU A 9 ILE A 12 AA 6 GLY A 172 ? LEU A 175 ? GLY A 172 LEU A 175 AA 7 ALA A 150 ? VAL A 154 ? ALA A 150 VAL A 154 AA 8 ALA A 124 ? ILE A 127 ? ALA A 124 ILE A 127 AA 9 GLY A 107 ? CYS A 108 ? GLY A 107 CYS A 108 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N CYS A 105 ? N CYS A 105 O ILE A 84 ? O ILE A 84 AA 2 3 N VAL A 85 ? N VAL A 85 O ALA A 64 ? O ALA A 64 AA 3 4 N GLY A 63 ? N GLY A 63 O VAL A 36 ? O VAL A 36 AA 4 5 N GLU A 37 ? N GLU A 37 O ALA A 11 ? O ALA A 11 AA 5 6 N ILE A 10 ? N ILE A 10 O ALA A 173 ? O ALA A 173 AA 6 7 N GLY A 174 ? N GLY A 174 O ALA A 153 ? O ALA A 153 AA 7 8 N PHE A 152 ? N PHE A 152 O LEU A 125 ? O LEU A 125 AA 8 9 O LYS A 126 ? O LYS A 126 N CYS A 108 ? N CYS A 108 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 15 _struct_site.details 'BINDING SITE FOR RESIDUE KDP A1207' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 15 ILE A 12 ? ILE A 12 . ? 1_555 ? 2 AC1 15 ARG A 14 ? ARG A 14 . ? 1_555 ? 3 AC1 15 THR A 66 ? THR A 66 . ? 1_555 ? 4 AC1 15 VAL A 85 ? VAL A 85 . ? 1_555 ? 5 AC1 15 THR A 86 ? THR A 86 . ? 1_555 ? 6 AC1 15 PRO A 87 ? PRO A 87 . ? 1_555 ? 7 AC1 15 LYS A 126 ? LYS A 126 . ? 1_555 ? 8 AC1 15 PHE A 128 ? PHE A 128 . ? 1_555 ? 9 AC1 15 VAL A 154 ? VAL A 154 . ? 1_555 ? 10 AC1 15 GLY A 155 ? GLY A 155 . ? 1_555 ? 11 AC1 15 GLY A 156 ? GLY A 156 . ? 1_555 ? 12 AC1 15 GLY A 176 ? GLY A 176 . ? 1_555 ? 13 AC1 15 SER A 177 ? SER A 177 . ? 1_555 ? 14 AC1 15 HOH C . ? HOH A 2047 . ? 1_555 ? 15 AC1 15 HOH C . ? HOH A 2061 . ? 1_555 ? # _database_PDB_matrix.entry_id 2V82 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2V82 _atom_sites.fract_transf_matrix[1][1] 0.009560 _atom_sites.fract_transf_matrix[1][2] 0.005520 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011039 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013475 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 TRP 3 3 3 TRP TRP A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 TRP 45 45 45 TRP TRP A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 MSE 79 79 79 MSE MSE A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 MSE 102 102 102 MSE MSE A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 THR 112 112 112 THR THR A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 TRP 165 165 165 TRP TRP A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ASP 167 167 167 ASP ASP A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 ASP 178 178 178 ASP ASP A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 TYR 180 180 180 TYR TYR A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 GLY 183 183 183 GLY GLY A . n A 1 184 GLN 184 184 184 GLN GLN A . n A 1 185 SER 185 185 185 SER SER A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 GLN 191 191 191 GLN GLN A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 ARG 201 201 201 ARG ARG A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 ALA 203 203 203 ALA ALA A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 HIS 208 208 ? ? ? A . n A 1 209 HIS 209 209 ? ? ? A . n A 1 210 HIS 210 210 ? ? ? A . n A 1 211 HIS 211 211 ? ? ? A . n A 1 212 HIS 212 212 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 KDP 1 1207 1207 KDP KDP A . C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . C 3 HOH 4 2004 2004 HOH HOH A . C 3 HOH 5 2005 2005 HOH HOH A . C 3 HOH 6 2006 2006 HOH HOH A . C 3 HOH 7 2007 2007 HOH HOH A . C 3 HOH 8 2008 2008 HOH HOH A . C 3 HOH 9 2009 2009 HOH HOH A . C 3 HOH 10 2010 2010 HOH HOH A . C 3 HOH 11 2011 2011 HOH HOH A . C 3 HOH 12 2012 2012 HOH HOH A . C 3 HOH 13 2013 2013 HOH HOH A . C 3 HOH 14 2014 2014 HOH HOH A . C 3 HOH 15 2015 2015 HOH HOH A . C 3 HOH 16 2016 2016 HOH HOH A . C 3 HOH 17 2017 2017 HOH HOH A . C 3 HOH 18 2018 2018 HOH HOH A . C 3 HOH 19 2019 2019 HOH HOH A . C 3 HOH 20 2020 2020 HOH HOH A . C 3 HOH 21 2021 2021 HOH HOH A . C 3 HOH 22 2022 2022 HOH HOH A . C 3 HOH 23 2023 2023 HOH HOH A . C 3 HOH 24 2024 2024 HOH HOH A . C 3 HOH 25 2025 2025 HOH HOH A . C 3 HOH 26 2026 2026 HOH HOH A . C 3 HOH 27 2027 2027 HOH HOH A . C 3 HOH 28 2028 2028 HOH HOH A . C 3 HOH 29 2029 2029 HOH HOH A . C 3 HOH 30 2030 2030 HOH HOH A . C 3 HOH 31 2031 2031 HOH HOH A . C 3 HOH 32 2032 2032 HOH HOH A . C 3 HOH 33 2033 2033 HOH HOH A . C 3 HOH 34 2034 2034 HOH HOH A . C 3 HOH 35 2035 2035 HOH HOH A . C 3 HOH 36 2036 2036 HOH HOH A . C 3 HOH 37 2037 2037 HOH HOH A . C 3 HOH 38 2038 2038 HOH HOH A . C 3 HOH 39 2039 2039 HOH HOH A . C 3 HOH 40 2040 2040 HOH HOH A . C 3 HOH 41 2041 2041 HOH HOH A . C 3 HOH 42 2042 2042 HOH HOH A . C 3 HOH 43 2043 2043 HOH HOH A . C 3 HOH 44 2044 2044 HOH HOH A . C 3 HOH 45 2045 2045 HOH HOH A . C 3 HOH 46 2046 2046 HOH HOH A . C 3 HOH 47 2047 2047 HOH HOH A . C 3 HOH 48 2048 2048 HOH HOH A . C 3 HOH 49 2049 2049 HOH HOH A . C 3 HOH 50 2050 2050 HOH HOH A . C 3 HOH 51 2051 2051 HOH HOH A . C 3 HOH 52 2052 2052 HOH HOH A . C 3 HOH 53 2053 2053 HOH HOH A . C 3 HOH 54 2054 2054 HOH HOH A . C 3 HOH 55 2055 2055 HOH HOH A . C 3 HOH 56 2056 2056 HOH HOH A . C 3 HOH 57 2057 2057 HOH HOH A . C 3 HOH 58 2058 2058 HOH HOH A . C 3 HOH 59 2059 2059 HOH HOH A . C 3 HOH 60 2060 2060 HOH HOH A . C 3 HOH 61 2061 2061 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 79 A MSE 79 ? MET SELENOMETHIONINE 2 A MSE 102 A MSE 102 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3670 ? 1 MORE -37.1 ? 1 'SSA (A^2)' 28470 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2029 ? C HOH . 2 1 A HOH 2036 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-03-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_abbrev' 2 3 'Structure model' '_citation.journal_id_ISSN' 3 3 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.pdbx_database_id_DOI' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation_author.name' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 18.0990 _pdbx_refine_tls.origin_y 8.5250 _pdbx_refine_tls.origin_z 0.0310 _pdbx_refine_tls.T[1][1] -0.0774 _pdbx_refine_tls.T[2][2] -0.1554 _pdbx_refine_tls.T[3][3] -0.1018 _pdbx_refine_tls.T[1][2] -0.0063 _pdbx_refine_tls.T[1][3] 0.0055 _pdbx_refine_tls.T[2][3] -0.0341 _pdbx_refine_tls.L[1][1] 3.7989 _pdbx_refine_tls.L[2][2] 0.7990 _pdbx_refine_tls.L[3][3] 1.1134 _pdbx_refine_tls.L[1][2] -0.4275 _pdbx_refine_tls.L[1][3] -0.6740 _pdbx_refine_tls.L[2][3] -0.1894 _pdbx_refine_tls.S[1][1] 0.1159 _pdbx_refine_tls.S[1][2] 0.0478 _pdbx_refine_tls.S[1][3] 0.3593 _pdbx_refine_tls.S[2][1] -0.0655 _pdbx_refine_tls.S[2][2] -0.0109 _pdbx_refine_tls.S[2][3] 0.0379 _pdbx_refine_tls.S[3][1] -0.1840 _pdbx_refine_tls.S[3][2] 0.0794 _pdbx_refine_tls.S[3][3] -0.1050 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 3 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 206 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # _pdbx_entry_details.entry_id 2V82 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details '2 KETO DEOXY GALACTOSE (KDP): COVALENT LINKAGE WITH A LYS 126' _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 8 ? ? -81.76 45.69 2 1 LEU A 13 ? ? -108.47 71.49 3 1 LEU A 206 ? ? -69.19 -100.08 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 207 ? CA ? A HIS 207 CA 2 1 Y 1 A HIS 207 ? C ? A HIS 207 C 3 1 Y 1 A HIS 207 ? O ? A HIS 207 O 4 1 Y 1 A HIS 207 ? CB ? A HIS 207 CB 5 1 Y 1 A HIS 207 ? CG ? A HIS 207 CG 6 1 Y 1 A HIS 207 ? ND1 ? A HIS 207 ND1 7 1 Y 1 A HIS 207 ? CD2 ? A HIS 207 CD2 8 1 Y 1 A HIS 207 ? CE1 ? A HIS 207 CE1 9 1 Y 1 A HIS 207 ? NE2 ? A HIS 207 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A HIS 208 ? A HIS 208 3 1 Y 1 A HIS 209 ? A HIS 209 4 1 Y 1 A HIS 210 ? A HIS 210 5 1 Y 1 A HIS 211 ? A HIS 211 6 1 Y 1 A HIS 212 ? A HIS 212 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-KETO-DEOXY-GALACTOSE KDP 3 water HOH #