data_2VU5 # _entry.id 2VU5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2VU5 PDBE EBI-36338 WWPDB D_1290036338 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2VU5 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-05-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Misra, G.' 1 'Aggarwal, A.' 2 'Dube, D.' 3 'Zaman, M.S.' 4 'Singh, Y.' 5 'Ramachandran, R.' 6 # _citation.id primary _citation.title ;Crystal Structure of the Bacillus Anthracis Nucleoside Diphosphate Kinase and its Characterization Reveals an Enzyme Adapted to Perform Under Stress Conditions. ; _citation.journal_abbrev Proteins _citation.journal_volume 76 _citation.page_first 496 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19241473 _citation.pdbx_database_id_DOI 10.1002/PROT.22364 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Misra, G.' 1 primary 'Aggarwal, A.' 2 primary 'Dube, D.' 3 primary 'Zaman, M.S.' 4 primary 'Singh, Y.' 5 primary 'Ramachandran, R.' 6 # _cell.entry_id 2VU5 _cell.length_a 107.531 _cell.length_b 107.531 _cell.length_c 52.301 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2VU5 _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NUCLEOSIDE DIPHOSPHATE KINASE' 16649.025 1 2.7.4.6 ? ? ? 2 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NDK, NDP KINASE, NUCLEOSIDE-2-P KINASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHEEKPFFGELVDFITSGPVFAMVWQGEGV VDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSLESAEREIGIFFKEEELVDYSKLMNEWIY ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHEEKPFFGELVDFITSGPVFAMVWQGEGV VDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSLESAEREIGIFFKEEELVDYSKLMNEWIY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 THR n 1 5 PHE n 1 6 LEU n 1 7 MET n 1 8 VAL n 1 9 LYS n 1 10 PRO n 1 11 ASP n 1 12 GLY n 1 13 VAL n 1 14 GLN n 1 15 ARG n 1 16 ALA n 1 17 PHE n 1 18 ILE n 1 19 GLY n 1 20 GLU n 1 21 ILE n 1 22 VAL n 1 23 ALA n 1 24 ARG n 1 25 PHE n 1 26 GLU n 1 27 LYS n 1 28 LYS n 1 29 GLY n 1 30 PHE n 1 31 GLN n 1 32 LEU n 1 33 VAL n 1 34 GLY n 1 35 ALA n 1 36 LYS n 1 37 LEU n 1 38 MET n 1 39 GLN n 1 40 VAL n 1 41 THR n 1 42 PRO n 1 43 GLU n 1 44 ILE n 1 45 ALA n 1 46 GLY n 1 47 GLN n 1 48 HIS n 1 49 TYR n 1 50 ALA n 1 51 GLU n 1 52 HIS n 1 53 GLU n 1 54 GLU n 1 55 LYS n 1 56 PRO n 1 57 PHE n 1 58 PHE n 1 59 GLY n 1 60 GLU n 1 61 LEU n 1 62 VAL n 1 63 ASP n 1 64 PHE n 1 65 ILE n 1 66 THR n 1 67 SER n 1 68 GLY n 1 69 PRO n 1 70 VAL n 1 71 PHE n 1 72 ALA n 1 73 MET n 1 74 VAL n 1 75 TRP n 1 76 GLN n 1 77 GLY n 1 78 GLU n 1 79 GLY n 1 80 VAL n 1 81 VAL n 1 82 ASP n 1 83 THR n 1 84 ALA n 1 85 ARG n 1 86 ASN n 1 87 MET n 1 88 MET n 1 89 GLY n 1 90 LYS n 1 91 THR n 1 92 ARG n 1 93 PRO n 1 94 HIS n 1 95 GLU n 1 96 ALA n 1 97 ALA n 1 98 PRO n 1 99 GLY n 1 100 THR n 1 101 ILE n 1 102 ARG n 1 103 GLY n 1 104 ASP n 1 105 PHE n 1 106 GLY n 1 107 VAL n 1 108 THR n 1 109 VAL n 1 110 ALA n 1 111 LYS n 1 112 ASN n 1 113 ILE n 1 114 ILE n 1 115 HIS n 1 116 GLY n 1 117 SER n 1 118 ASP n 1 119 SER n 1 120 LEU n 1 121 GLU n 1 122 SER n 1 123 ALA n 1 124 GLU n 1 125 ARG n 1 126 GLU n 1 127 ILE n 1 128 GLY n 1 129 ILE n 1 130 PHE n 1 131 PHE n 1 132 LYS n 1 133 GLU n 1 134 GLU n 1 135 GLU n 1 136 LEU n 1 137 VAL n 1 138 ASP n 1 139 TYR n 1 140 SER n 1 141 LYS n 1 142 LEU n 1 143 MET n 1 144 ASN n 1 145 GLU n 1 146 TRP n 1 147 ILE n 1 148 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS ANTHRACIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1392 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NDK_BACAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q81SV8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2VU5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q81SV8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 148 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2VU5 _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 53 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q81SV8 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 53 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 53 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2VU5 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.1 _exptl_crystal.density_percent_sol 36.9 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 8' # _diffrn.id 1 _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details 'YALE MIRRORS' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2VU5 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 26.70 _reflns.d_resolution_high 2.00 _reflns.number_obs 12490 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.90 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.3 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2VU5 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 11540 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 93.25 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 99.63 _refine.ls_R_factor_obs 0.17707 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17348 _refine.ls_R_factor_R_free 0.22272 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.5 _refine.ls_number_reflns_R_free 931 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.B_iso_mean 26.369 _refine.aniso_B[1][1] -0.08 _refine.aniso_B[2][2] -0.08 _refine.aniso_B[3][3] 0.12 _refine.aniso_B[1][2] -0.04 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.152 _refine.pdbx_overall_ESU_R_Free 0.148 _refine.overall_SU_ML 0.097 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.441 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1170 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 80 _refine_hist.number_atoms_total 1250 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 93.25 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.022 ? 1156 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.500 1.945 ? 1559 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.840 5.000 ? 146 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 40.172 23.922 ? 51 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.169 15.000 ? 189 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 29.035 15.000 ? 6 'X-RAY DIFFRACTION' ? r_chiral_restr 0.110 0.200 ? 168 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.020 ? 881 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.230 0.200 ? 443 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.309 0.200 ? 793 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.123 0.200 ? 63 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.173 0.200 ? 46 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.333 0.200 ? 12 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.135 1.500 ? 746 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.860 2.000 ? 1156 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.091 3.000 ? 463 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 5.390 4.500 ? 403 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.000 _refine_ls_shell.d_res_low 2.052 _refine_ls_shell.number_reflns_R_work 833 _refine_ls_shell.R_factor_R_work 0.233 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.296 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 63 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2VU5 _struct.title 'Crystal structure of Pndk from Bacillus anthracis' _struct.pdbx_descriptor 'NUCLEOSIDE DIPHOSPHATE KINASE (E.C.2.7.4.6)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2VU5 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;BACILLUS ANTHRACIS, NUCLEOTIDE-BINDING, ATP-BINDING, METAL-BINDING, PHOSPHOPROTEIN, NUCLEOTIDE METABOLISM, NUCLEOSIDE DIPHOSPHATE KINASE, KINASE, CYTOPLASM, MAGNESIUM, TRANSFERASE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 9 ? ARG A 15 ? LYS A 9 ARG A 15 1 ? 7 HELX_P HELX_P2 2 PHE A 17 ? GLY A 29 ? PHE A 17 GLY A 29 1 ? 13 HELX_P HELX_P3 3 THR A 41 ? HIS A 48 ? THR A 41 HIS A 48 1 ? 8 HELX_P HELX_P4 4 TYR A 49 ? HIS A 52 ? TYR A 49 HIS A 52 5 ? 4 HELX_P HELX_P5 5 PRO A 56 ? ILE A 65 ? PRO A 56 ILE A 65 1 ? 10 HELX_P HELX_P6 6 GLY A 79 ? GLY A 89 ? GLY A 79 GLY A 89 1 ? 11 HELX_P HELX_P7 7 THR A 100 ? GLY A 106 ? THR A 100 GLY A 106 1 ? 7 HELX_P HELX_P8 8 SER A 119 ? PHE A 131 ? SER A 119 PHE A 131 1 ? 13 HELX_P HELX_P9 9 LYS A 132 ? LEU A 136 ? LYS A 132 LEU A 136 5 ? 5 HELX_P HELX_P10 10 LYS A 141 ? ILE A 147 ? LYS A 141 ILE A 147 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 31 ? MET A 38 ? GLN A 31 MET A 38 AA 2 VAL A 70 ? GLN A 76 ? VAL A 70 GLN A 76 AA 3 LYS A 3 ? VAL A 8 ? LYS A 3 VAL A 8 AA 4 ILE A 114 ? GLY A 116 ? ILE A 114 GLY A 116 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N MET A 38 ? N MET A 38 O VAL A 70 ? O VAL A 70 AA 2 3 N TRP A 75 ? N TRP A 75 O THR A 4 ? O THR A 4 AA 3 4 N MET A 7 ? N MET A 7 O HIS A 115 ? O HIS A 115 # _database_PDB_matrix.entry_id 2VU5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2VU5 _atom_sites.fract_transf_matrix[1][1] 0.009300 _atom_sites.fract_transf_matrix[1][2] 0.005369 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010738 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019120 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 MET 88 88 88 MET MET A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 HIS 94 94 94 HIS HIS A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 GLU 126 126 126 GLU GLU A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ASP 138 138 138 ASP ASP A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 MET 143 143 143 MET MET A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 TRP 146 146 146 TRP TRP A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 TYR 148 148 148 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . B 2 HOH 27 2027 2027 HOH HOH A . B 2 HOH 28 2028 2028 HOH HOH A . B 2 HOH 29 2029 2029 HOH HOH A . B 2 HOH 30 2030 2030 HOH HOH A . B 2 HOH 31 2031 2031 HOH HOH A . B 2 HOH 32 2032 2032 HOH HOH A . B 2 HOH 33 2033 2033 HOH HOH A . B 2 HOH 34 2034 2034 HOH HOH A . B 2 HOH 35 2035 2035 HOH HOH A . B 2 HOH 36 2036 2036 HOH HOH A . B 2 HOH 37 2037 2037 HOH HOH A . B 2 HOH 38 2038 2038 HOH HOH A . B 2 HOH 39 2039 2039 HOH HOH A . B 2 HOH 40 2040 2040 HOH HOH A . B 2 HOH 41 2041 2041 HOH HOH A . B 2 HOH 42 2042 2042 HOH HOH A . B 2 HOH 43 2043 2043 HOH HOH A . B 2 HOH 44 2044 2044 HOH HOH A . B 2 HOH 45 2045 2045 HOH HOH A . B 2 HOH 46 2046 2046 HOH HOH A . B 2 HOH 47 2047 2047 HOH HOH A . B 2 HOH 48 2048 2048 HOH HOH A . B 2 HOH 49 2049 2049 HOH HOH A . B 2 HOH 50 2050 2050 HOH HOH A . B 2 HOH 51 2051 2051 HOH HOH A . B 2 HOH 52 2052 2052 HOH HOH A . B 2 HOH 53 2053 2053 HOH HOH A . B 2 HOH 54 2054 2054 HOH HOH A . B 2 HOH 55 2055 2055 HOH HOH A . B 2 HOH 56 2056 2056 HOH HOH A . B 2 HOH 57 2057 2057 HOH HOH A . B 2 HOH 58 2058 2058 HOH HOH A . B 2 HOH 59 2059 2059 HOH HOH A . B 2 HOH 60 2060 2060 HOH HOH A . B 2 HOH 61 2061 2061 HOH HOH A . B 2 HOH 62 2062 2062 HOH HOH A . B 2 HOH 63 2063 2063 HOH HOH A . B 2 HOH 64 2064 2064 HOH HOH A . B 2 HOH 65 2065 2065 HOH HOH A . B 2 HOH 66 2066 2066 HOH HOH A . B 2 HOH 67 2067 2067 HOH HOH A . B 2 HOH 68 2068 2068 HOH HOH A . B 2 HOH 69 2069 2069 HOH HOH A . B 2 HOH 70 2070 2070 HOH HOH A . B 2 HOH 71 2071 2071 HOH HOH A . B 2 HOH 72 2072 2072 HOH HOH A . B 2 HOH 73 2073 2073 HOH HOH A . B 2 HOH 74 2074 2074 HOH HOH A . B 2 HOH 75 2075 2075 HOH HOH A . B 2 HOH 76 2076 2076 HOH HOH A . B 2 HOH 77 2077 2077 HOH HOH A . B 2 HOH 78 2078 2078 HOH HOH A . B 2 HOH 79 2079 2079 HOH HOH A . B 2 HOH 80 2080 2080 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details hexameric _pdbx_struct_assembly.oligomeric_count 6 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 17740 ? 1 MORE -113.4 ? 1 'SSA (A^2)' 41740 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_555 -x+y,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 26.1505000000 3 'crystal symmetry operation' 3_565 -x+y,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -53.7655000000 -0.8660254038 -0.5000000000 0.0000000000 93.1245776943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 53.7655000000 0.8660254038 -0.5000000000 0.0000000000 93.1245776943 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/2 0.5000000000 0.8660254038 0.0000000000 -53.7655000000 0.8660254038 -0.5000000000 0.0000000000 93.1245776943 0.0000000000 0.0000000000 -1.0000000000 26.1505000000 6 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/2 0.5000000000 -0.8660254038 0.0000000000 53.7655000000 -0.8660254038 -0.5000000000 0.0000000000 93.1245776943 0.0000000000 0.0000000000 -1.0000000000 26.1505000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2029 ? B HOH . 2 1 A HOH 2030 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-10 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0005 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG1 A VAL 13 ? ? CB A VAL 13 ? ? CG2 A VAL 13 ? ? 121.48 110.90 10.58 1.60 N 2 1 OE1 A GLN 47 ? ? CD A GLN 47 ? ? NE2 A GLN 47 ? ? 88.56 121.90 -33.34 2.30 N 3 1 CA A GLU 53 ? ? CB A GLU 53 ? ? CG A GLU 53 ? ? 127.76 113.40 14.36 2.20 N 4 1 CA A GLU 54 ? ? CB A GLU 54 ? ? CG A GLU 54 ? ? 127.97 113.40 14.57 2.20 N 5 1 NE A ARG 102 ? ? CZ A ARG 102 ? ? NH1 A ARG 102 ? ? 114.53 120.30 -5.77 0.50 N 6 1 NE A ARG 102 ? ? CZ A ARG 102 ? ? NH2 A ARG 102 ? ? 125.24 120.30 4.94 0.50 N 7 1 CG A MET 143 ? ? SD A MET 143 ? ? CE A MET 143 ? ? 110.20 100.20 10.00 1.60 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ILE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 113 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 80.02 _pdbx_validate_torsion.psi -48.89 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLN _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 47 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.182 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A VAL 13 ? C ? A VAL 13 C 2 1 Y 0 A VAL 13 ? O ? A VAL 13 O 3 1 Y 0 A VAL 13 ? CG1 ? A VAL 13 CG1 4 1 Y 0 A VAL 13 ? CG2 ? A VAL 13 CG2 5 1 Y 0 A LYS 27 ? CG ? A LYS 27 CG 6 1 Y 0 A LYS 27 ? CD ? A LYS 27 CD 7 1 Y 0 A LYS 27 ? CE ? A LYS 27 CE 8 1 Y 0 A LYS 27 ? NZ ? A LYS 27 NZ 9 1 Y 0 A GLU 43 ? CG ? A GLU 43 CG 10 1 Y 0 A GLU 43 ? CD ? A GLU 43 CD 11 1 Y 0 A GLU 43 ? OE1 ? A GLU 43 OE1 12 1 Y 0 A GLU 43 ? OE2 ? A GLU 43 OE2 13 1 Y 0 A GLN 47 ? CG ? A GLN 47 CG 14 1 Y 0 A GLN 47 ? CD ? A GLN 47 CD 15 1 Y 0 A GLN 47 ? OE1 ? A GLN 47 OE1 16 1 Y 0 A GLU 53 ? CG ? A GLU 53 CG 17 1 Y 0 A GLU 53 ? CD ? A GLU 53 CD 18 1 Y 0 A GLU 53 ? OE1 ? A GLU 53 OE1 19 1 Y 0 A GLU 53 ? OE2 ? A GLU 53 OE2 20 1 Y 0 A GLU 54 ? CG ? A GLU 54 CG 21 1 Y 0 A GLU 54 ? CD ? A GLU 54 CD 22 1 Y 0 A GLU 54 ? OE1 ? A GLU 54 OE1 23 1 Y 0 A GLU 54 ? OE2 ? A GLU 54 OE2 24 1 Y 0 A LYS 55 ? CG ? A LYS 55 CG 25 1 Y 0 A LYS 55 ? CD ? A LYS 55 CD 26 1 Y 0 A LYS 55 ? CE ? A LYS 55 CE 27 1 Y 0 A LYS 55 ? NZ ? A LYS 55 NZ 28 1 Y 0 A ASP 63 ? CG ? A ASP 63 CG 29 1 Y 0 A ASP 63 ? OD1 ? A ASP 63 OD1 30 1 Y 0 A ASP 63 ? OD2 ? A ASP 63 OD2 31 1 Y 0 A HIS 94 ? CG ? A HIS 94 CG 32 1 Y 0 A HIS 94 ? ND1 ? A HIS 94 ND1 33 1 Y 0 A HIS 94 ? CD2 ? A HIS 94 CD2 34 1 Y 0 A HIS 94 ? CE1 ? A HIS 94 CE1 35 1 Y 0 A HIS 94 ? NE2 ? A HIS 94 NE2 36 1 Y 0 A MET 143 ? CG ? A MET 143 CG 37 1 Y 0 A MET 143 ? SD ? A MET 143 SD 38 1 Y 0 A MET 143 ? CE ? A MET 143 CE # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #