data_2VY5 # _entry.id 2VY5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2VY5 pdb_00002vy5 10.2210/pdb2vy5/pdb PDBE EBI-36937 ? ? WWPDB D_1290036937 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-17 2 'Structure model' 1 1 2012-04-18 3 'Structure model' 1 2 2018-01-24 4 'Structure model' 1 3 2018-05-09 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' Other 4 2 'Structure model' 'Refinement description' 5 2 'Structure model' 'Version format compliance' 6 3 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Database references' 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' 11 5 'Structure model' 'Derived calculations' 12 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_src_gen 2 4 'Structure model' citation 3 4 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 7 5 'Structure model' pdbx_database_status 8 5 'Structure model' pdbx_nmr_spectrometer 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 2 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name' 3 3 'Structure model' '_entity_src_gen.pdbx_host_org_strain' 4 3 'Structure model' '_entity_src_gen.pdbx_host_org_variant' 5 4 'Structure model' '_citation.page_last' 6 4 'Structure model' '_citation.pdbx_database_id_DOI' 7 4 'Structure model' '_citation.title' 8 4 'Structure model' '_pdbx_nmr_spectrometer.model' 9 5 'Structure model' '_database_2.pdbx_DOI' 10 5 'Structure model' '_database_2.pdbx_database_accession' 11 5 'Structure model' '_pdbx_database_status.status_code_mr' 12 5 'Structure model' '_pdbx_nmr_spectrometer.model' 13 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 14 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 15 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 16 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 17 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 18 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 19 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 20 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 21 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 22 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 23 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 24 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 25 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2VY5 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-07-18 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2VY4 _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'U11-48K CHHC ZN-FINGER PROTEIN DOMAIN' # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tidow, H.' 1 ? 'Andreeva, A.' 2 ? 'Rutherford, T.J.' 3 ? 'Fersht, A.R.' 4 ? # _citation.id primary _citation.title ;Solution structure of the U11-48K CHHC zinc-finger domain that specifically binds the 5' splice site of U12-type introns. ; _citation.journal_abbrev Structure _citation.journal_volume 17 _citation.page_first 294 _citation.page_last 302 _citation.year 2009 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19217400 _citation.pdbx_database_id_DOI 10.1016/j.str.2008.11.013 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tidow, H.' 1 ? primary 'Andreeva, A.' 2 ? primary 'Rutherford, T.J.' 3 ? primary 'Fersht, A.R.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'U11/U12 SMALL NUCLEAR RIBONUCLEOPROTEIN 48 KDA PROTEIN' 4187.892 1 ? ? 'RESIDUES 53-87' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U11/U12 SNRNP 48 KDA PROTEIN, U11/U12-48K, U11-48K CHHC ZN-FINGER' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTK _entity_poly.pdbx_seq_one_letter_code_can GSDEVVICPYDSNHHMPKSSLAKHMASCRLRKMGYTK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ASP n 1 4 GLU n 1 5 VAL n 1 6 VAL n 1 7 ILE n 1 8 CYS n 1 9 PRO n 1 10 TYR n 1 11 ASP n 1 12 SER n 1 13 ASN n 1 14 HIS n 1 15 HIS n 1 16 MET n 1 17 PRO n 1 18 LYS n 1 19 SER n 1 20 SER n 1 21 LEU n 1 22 ALA n 1 23 LYS n 1 24 HIS n 1 25 MET n 1 26 ALA n 1 27 SER n 1 28 CYS n 1 29 ARG n 1 30 LEU n 1 31 ARG n 1 32 LYS n 1 33 MET n 1 34 GLY n 1 35 TYR n 1 36 THR n 1 37 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant C41 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PRSET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 51 51 GLY GLY A . n A 1 2 SER 2 52 52 SER SER A . n A 1 3 ASP 3 53 53 ASP ASP A . n A 1 4 GLU 4 54 54 GLU GLU A . n A 1 5 VAL 5 55 55 VAL VAL A . n A 1 6 VAL 6 56 56 VAL VAL A . n A 1 7 ILE 7 57 57 ILE ILE A . n A 1 8 CYS 8 58 58 CYS CYS A . n A 1 9 PRO 9 59 59 PRO PRO A . n A 1 10 TYR 10 60 60 TYR TYR A . n A 1 11 ASP 11 61 61 ASP ASP A . n A 1 12 SER 12 62 62 SER SER A . n A 1 13 ASN 13 63 63 ASN ASN A . n A 1 14 HIS 14 64 64 HIS HIS A . n A 1 15 HIS 15 65 65 HIS HIS A . n A 1 16 MET 16 66 66 MET MET A . n A 1 17 PRO 17 67 67 PRO PRO A . n A 1 18 LYS 18 68 68 LYS LYS A . n A 1 19 SER 19 69 69 SER SER A . n A 1 20 SER 20 70 70 SER SER A . n A 1 21 LEU 21 71 71 LEU LEU A . n A 1 22 ALA 22 72 72 ALA ALA A . n A 1 23 LYS 23 73 73 LYS LYS A . n A 1 24 HIS 24 74 74 HIS HIS A . n A 1 25 MET 25 75 75 MET MET A . n A 1 26 ALA 26 76 76 ALA ALA A . n A 1 27 SER 27 77 77 SER SER A . n A 1 28 CYS 28 78 78 CYS CYS A . n A 1 29 ARG 29 79 79 ARG ARG A . n A 1 30 LEU 30 80 80 LEU LEU A . n A 1 31 ARG 31 81 81 ARG ARG A . n A 1 32 LYS 32 82 82 LYS LYS A . n A 1 33 MET 33 83 83 MET MET A . n A 1 34 GLY 34 84 84 GLY GLY A . n A 1 35 TYR 35 85 85 TYR TYR A . n A 1 36 THR 36 86 86 THR THR A . n A 1 37 LYS 37 87 87 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1088 _pdbx_nonpoly_scheme.auth_seq_num 1088 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2VY5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2VY5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2VY5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2VY5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2VY5 _struct.title 'U11-48K CHHC Zn-finger protein domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'MINIMIZED AVERAGE' # _struct_keywords.entry_id 2VY5 _struct_keywords.pdbx_keywords SPLICING _struct_keywords.text 'SPLICING, MRNA PROCESSING, ALTERNATIVE SPLICING, TRANSCRIPTION, NUCLEUS, SPLICEOSOME, POLYMORPHISM, MRNA SPLICING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2VY5 1 ? ? 2VY5 ? 2 UNP CF151_HUMAN 1 ? ? Q6IEG0 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2VY5 A 1 ? 2 ? 2VY5 51 ? 52 ? 51 52 2 2 2VY5 A 3 ? 37 ? Q6IEG0 53 ? 87 ? 53 87 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 21 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 32 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 71 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 82 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 58 A ZN 1088 1_555 ? ? ? ? ? ? ? 2.348 ? ? metalc2 metalc ? ? A HIS 14 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 64 A ZN 1088 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc3 metalc ? ? A HIS 24 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 74 A ZN 1088 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc4 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 78 A ZN 1088 1_555 ? ? ? ? ? ? ? 2.316 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 8 ? A CYS 58 ? 1_555 ZN ? B ZN . ? A ZN 1088 ? 1_555 ND1 ? A HIS 14 ? A HIS 64 ? 1_555 109.8 ? 2 SG ? A CYS 8 ? A CYS 58 ? 1_555 ZN ? B ZN . ? A ZN 1088 ? 1_555 ND1 ? A HIS 24 ? A HIS 74 ? 1_555 109.3 ? 3 ND1 ? A HIS 14 ? A HIS 64 ? 1_555 ZN ? B ZN . ? A ZN 1088 ? 1_555 ND1 ? A HIS 24 ? A HIS 74 ? 1_555 123.1 ? 4 SG ? A CYS 8 ? A CYS 58 ? 1_555 ZN ? B ZN . ? A ZN 1088 ? 1_555 SG ? A CYS 28 ? A CYS 78 ? 1_555 100.6 ? 5 ND1 ? A HIS 14 ? A HIS 64 ? 1_555 ZN ? B ZN . ? A ZN 1088 ? 1_555 SG ? A CYS 28 ? A CYS 78 ? 1_555 99.6 ? 6 ND1 ? A HIS 24 ? A HIS 74 ? 1_555 ZN ? B ZN . ? A ZN 1088 ? 1_555 SG ? A CYS 28 ? A CYS 78 ? 1_555 111.8 ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 6 ? CYS A 8 ? VAL A 56 CYS A 58 AA 2 ASN A 13 ? MET A 16 ? ASN A 63 MET A 66 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 6 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 56 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 16 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 66 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 1088 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 1088' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 8 ? CYS A 58 . ? 1_555 ? 2 AC1 5 HIS A 14 ? HIS A 64 . ? 1_555 ? 3 AC1 5 MET A 16 ? MET A 66 . ? 1_555 ? 4 AC1 5 HIS A 24 ? HIS A 74 . ? 1_555 ? 5 AC1 5 CYS A 28 ? CYS A 78 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 74 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 78 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 52 ? ? -66.68 83.76 2 1 ASP A 53 ? ? -159.14 65.30 3 1 PRO A 59 ? ? -84.71 48.09 4 1 TYR A 60 ? ? -134.43 -49.20 5 1 ASP A 61 ? ? -99.33 -79.07 6 1 SER A 62 ? ? 144.61 -55.25 7 1 ASN A 63 ? ? -94.87 46.20 8 1 TYR A 85 ? ? -178.00 116.08 # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ; HELIX DETERMINATION METHOD: AUTHOR PROVIDED. ; 700 ; SHEET DETERMINATION METHOD: AUTHOR PROVIDED. ; # _pdbx_nmr_ensemble.entry_id 2VY5 _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '25MM PHOSPHATE, PH7.2, 150MM NACL, 5MM DTT, 5%D2O' _pdbx_nmr_sample_details.solvent_system ? _pdbx_nmr_sample_details.label ? _pdbx_nmr_sample_details.type ? _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 213 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 3 1 TOCSY 1 4 1 HNCACB 1 5 1 CBCA 1 # _pdbx_nmr_details.entry_id 2VY5 _pdbx_nmr_details.text 'ASSIGNMENT USING TRIPLE-RESONANCE NMR SPECTROSCOPY' # _pdbx_nmr_refine.entry_id 2VY5 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'DETAILS CAN BE FOUND IN CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' CNS ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PRO N N N N 227 PRO CA C N S 228 PRO C C N N 229 PRO O O N N 230 PRO CB C N N 231 PRO CG C N N 232 PRO CD C N N 233 PRO OXT O N N 234 PRO H H N N 235 PRO HA H N N 236 PRO HB2 H N N 237 PRO HB3 H N N 238 PRO HG2 H N N 239 PRO HG3 H N N 240 PRO HD2 H N N 241 PRO HD3 H N N 242 PRO HXT H N N 243 SER N N N N 244 SER CA C N S 245 SER C C N N 246 SER O O N N 247 SER CB C N N 248 SER OG O N N 249 SER OXT O N N 250 SER H H N N 251 SER H2 H N N 252 SER HA H N N 253 SER HB2 H N N 254 SER HB3 H N N 255 SER HG H N N 256 SER HXT H N N 257 THR N N N N 258 THR CA C N S 259 THR C C N N 260 THR O O N N 261 THR CB C N R 262 THR OG1 O N N 263 THR CG2 C N N 264 THR OXT O N N 265 THR H H N N 266 THR H2 H N N 267 THR HA H N N 268 THR HB H N N 269 THR HG1 H N N 270 THR HG21 H N N 271 THR HG22 H N N 272 THR HG23 H N N 273 THR HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 ZN ZN ZN N N 318 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TYR N CA sing N N 262 TYR N H sing N N 263 TYR N H2 sing N N 264 TYR CA C sing N N 265 TYR CA CB sing N N 266 TYR CA HA sing N N 267 TYR C O doub N N 268 TYR C OXT sing N N 269 TYR CB CG sing N N 270 TYR CB HB2 sing N N 271 TYR CB HB3 sing N N 272 TYR CG CD1 doub Y N 273 TYR CG CD2 sing Y N 274 TYR CD1 CE1 sing Y N 275 TYR CD1 HD1 sing N N 276 TYR CD2 CE2 doub Y N 277 TYR CD2 HD2 sing N N 278 TYR CE1 CZ doub Y N 279 TYR CE1 HE1 sing N N 280 TYR CE2 CZ sing Y N 281 TYR CE2 HE2 sing N N 282 TYR CZ OH sing N N 283 TYR OH HH sing N N 284 TYR OXT HXT sing N N 285 VAL N CA sing N N 286 VAL N H sing N N 287 VAL N H2 sing N N 288 VAL CA C sing N N 289 VAL CA CB sing N N 290 VAL CA HA sing N N 291 VAL C O doub N N 292 VAL C OXT sing N N 293 VAL CB CG1 sing N N 294 VAL CB CG2 sing N N 295 VAL CB HB sing N N 296 VAL CG1 HG11 sing N N 297 VAL CG1 HG12 sing N N 298 VAL CG1 HG13 sing N N 299 VAL CG2 HG21 sing N N 300 VAL CG2 HG22 sing N N 301 VAL CG2 HG23 sing N N 302 VAL OXT HXT sing N N 303 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2VY5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_