data_2VZJ # _entry.id 2VZJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2VZJ PDBE EBI-37098 WWPDB D_1290037098 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2013-08-07 _pdbx_database_PDB_obs_spr.pdb_id 4LTN _pdbx_database_PDB_obs_spr.replace_pdb_id 2VZJ _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2VZH unspecified 'STRUCTURES OF NADH:FMN OXIDOREDUCTASE (EMOB)- FMN COMPLEX' PDB 2VZF unspecified 'CRYSTAL STRUCTURES OF NADH:FMN OXIDOREDUCTASE (EMOB)-APO FORM' # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 2VZJ _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-08-01 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nissen, M.S.' 1 'Youn, B.' 2 'Knowles, B.D.' 3 'Ballinger, J.W.' 4 'Jun, S.Y.' 5 'Belchik, S.M.' 6 'Xun, L.' 7 'Kang, C.' 8 # _citation.id primary _citation.title 'Crystal Structures of Nadh:Fmn Oxidoreductase (Emob) at Different Stages of Catalysis.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 28710 _citation.page_last ? _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18701448 _citation.pdbx_database_id_DOI 10.1074/JBC.M804535200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Nissen, M.S.' 1 primary 'Youn, B.' 2 primary 'Knowles, B.D.' 3 primary 'Ballinger, J.W.' 4 primary 'Jun, S.Y.' 5 primary 'Belchik, S.M.' 6 primary 'Xun, L.' 7 primary 'Kang, C.' 8 # _cell.entry_id 2VZJ _cell.length_a 101.180 _cell.length_b 101.180 _cell.length_c 129.710 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2VZJ _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NADH-DEPENDENT FMN REDUCTASE' 20956.916 1 ? ? ? ? 2 non-polymer syn 'FLAVIN MONONUCLEOTIDE' 456.344 1 ? ? ? ? 3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 1 ? ? ? ? 4 water nat water 18.015 128 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIY KASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFLVQSQFSVVDGKLAVEDDV ASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDATRAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MTYSIVAISGSPSRNSTTAKLAEYALAHVLARSDSQGRHIHVIDLDPKALLRGDLSNAKLKEAVDATCNADGLIVATPIY KASYTGLLKAFLDILPQFALAGKAALPLATGGSPAHVLALDYGLRPVLHSMGVRHVVQSFFLVQSQFSVVDGKLAVEDDV ASQLNNAIDHFRLSLSSEPSTRHLGHPRPSLDATRAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 TYR n 1 4 SER n 1 5 ILE n 1 6 VAL n 1 7 ALA n 1 8 ILE n 1 9 SER n 1 10 GLY n 1 11 SER n 1 12 PRO n 1 13 SER n 1 14 ARG n 1 15 ASN n 1 16 SER n 1 17 THR n 1 18 THR n 1 19 ALA n 1 20 LYS n 1 21 LEU n 1 22 ALA n 1 23 GLU n 1 24 TYR n 1 25 ALA n 1 26 LEU n 1 27 ALA n 1 28 HIS n 1 29 VAL n 1 30 LEU n 1 31 ALA n 1 32 ARG n 1 33 SER n 1 34 ASP n 1 35 SER n 1 36 GLN n 1 37 GLY n 1 38 ARG n 1 39 HIS n 1 40 ILE n 1 41 HIS n 1 42 VAL n 1 43 ILE n 1 44 ASP n 1 45 LEU n 1 46 ASP n 1 47 PRO n 1 48 LYS n 1 49 ALA n 1 50 LEU n 1 51 LEU n 1 52 ARG n 1 53 GLY n 1 54 ASP n 1 55 LEU n 1 56 SER n 1 57 ASN n 1 58 ALA n 1 59 LYS n 1 60 LEU n 1 61 LYS n 1 62 GLU n 1 63 ALA n 1 64 VAL n 1 65 ASP n 1 66 ALA n 1 67 THR n 1 68 CYS n 1 69 ASN n 1 70 ALA n 1 71 ASP n 1 72 GLY n 1 73 LEU n 1 74 ILE n 1 75 VAL n 1 76 ALA n 1 77 THR n 1 78 PRO n 1 79 ILE n 1 80 TYR n 1 81 LYS n 1 82 ALA n 1 83 SER n 1 84 TYR n 1 85 THR n 1 86 GLY n 1 87 LEU n 1 88 LEU n 1 89 LYS n 1 90 ALA n 1 91 PHE n 1 92 LEU n 1 93 ASP n 1 94 ILE n 1 95 LEU n 1 96 PRO n 1 97 GLN n 1 98 PHE n 1 99 ALA n 1 100 LEU n 1 101 ALA n 1 102 GLY n 1 103 LYS n 1 104 ALA n 1 105 ALA n 1 106 LEU n 1 107 PRO n 1 108 LEU n 1 109 ALA n 1 110 THR n 1 111 GLY n 1 112 GLY n 1 113 SER n 1 114 PRO n 1 115 ALA n 1 116 HIS n 1 117 VAL n 1 118 LEU n 1 119 ALA n 1 120 LEU n 1 121 ASP n 1 122 TYR n 1 123 GLY n 1 124 LEU n 1 125 ARG n 1 126 PRO n 1 127 VAL n 1 128 LEU n 1 129 HIS n 1 130 SER n 1 131 MET n 1 132 GLY n 1 133 VAL n 1 134 ARG n 1 135 HIS n 1 136 VAL n 1 137 VAL n 1 138 GLN n 1 139 SER n 1 140 PHE n 1 141 PHE n 1 142 LEU n 1 143 VAL n 1 144 GLN n 1 145 SER n 1 146 GLN n 1 147 PHE n 1 148 SER n 1 149 VAL n 1 150 VAL n 1 151 ASP n 1 152 GLY n 1 153 LYS n 1 154 LEU n 1 155 ALA n 1 156 VAL n 1 157 GLU n 1 158 ASP n 1 159 ASP n 1 160 VAL n 1 161 ALA n 1 162 SER n 1 163 GLN n 1 164 LEU n 1 165 ASN n 1 166 ASN n 1 167 ALA n 1 168 ILE n 1 169 ASP n 1 170 HIS n 1 171 PHE n 1 172 ARG n 1 173 LEU n 1 174 SER n 1 175 LEU n 1 176 SER n 1 177 SER n 1 178 GLU n 1 179 PRO n 1 180 SER n 1 181 THR n 1 182 ARG n 1 183 HIS n 1 184 LEU n 1 185 GLY n 1 186 HIS n 1 187 PRO n 1 188 ARG n 1 189 PRO n 1 190 SER n 1 191 LEU n 1 192 ASP n 1 193 ALA n 1 194 THR n 1 195 ARG n 1 196 ALA n 1 197 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EMOB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'EDTA-DEGRADING BACTERIUM BNC1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 85561 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9F9T2_9PROT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q9F9T2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2VZJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 197 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9F9T2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 197 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 197 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMN non-polymer . 'FLAVIN MONONUCLEOTIDE' 'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2VZJ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.3 _exptl_crystal.density_percent_sol 71.2 _exptl_crystal.description NONE # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.54 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2VZJ _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 2.50 _reflns.number_obs 233200 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.04 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5.2 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2VZJ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 13264 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 12 _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs 96 _refine.ls_R_factor_obs 0.202 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.202 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1384 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 75 _refine_hist.number_atoms_solvent 128 _refine_hist.number_atoms_total 1587 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 12 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.016 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 3.82 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2VZJ _struct.title 'CRYSTAL STRUCTURES OF NADH:FMN OXIDOREDUCTASE (EMOB)-FMN, NADH complex' _struct.pdbx_descriptor 'NADH-DEPENDENT FMN REDUCTASE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2VZJ _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? SER A 33 ? SER A 16 SER A 33 1 ? 18 HELX_P HELX_P2 2 ILE A 43 ? LEU A 45 ? ILE A 43 LEU A 45 5 ? 3 HELX_P HELX_P3 3 ASP A 46 ? GLY A 53 ? ASP A 46 GLY A 53 1 ? 8 HELX_P HELX_P4 4 ASN A 57 ? ALA A 70 ? ASN A 57 ALA A 70 1 ? 14 HELX_P HELX_P5 5 THR A 85 ? ASP A 93 ? THR A 85 ASP A 93 1 ? 9 HELX_P HELX_P6 6 SER A 113 ? VAL A 117 ? SER A 113 VAL A 117 5 ? 5 HELX_P HELX_P7 7 LEU A 118 ? GLY A 123 ? LEU A 118 GLY A 123 1 ? 6 HELX_P HELX_P8 8 GLY A 123 ? SER A 130 ? GLY A 123 SER A 130 1 ? 8 HELX_P HELX_P9 9 GLU A 157 ? SER A 174 ? GLU A 157 SER A 174 1 ? 18 HELX_P HELX_P10 10 GLU A 178 ? LEU A 184 ? GLU A 178 LEU A 184 5 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? parallel AB 1 2 ? parallel AB 2 3 ? parallel AB 3 4 ? parallel AB 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 SER A 35 ? HIS A 41 ? SER A 35 HIS A 41 AA 2 TYR A 3 ? SER A 9 ? TYR A 3 SER A 9 AA 3 GLY A 72 ? PRO A 78 ? GLY A 72 PRO A 78 AA 4 ALA A 104 ? GLY A 111 ? ALA A 104 GLY A 111 AA 5 HIS A 135 ? VAL A 136 ? HIS A 135 VAL A 136 AB 1 SER A 35 ? HIS A 41 ? SER A 35 HIS A 41 AB 2 TYR A 3 ? SER A 9 ? TYR A 3 SER A 9 AB 3 GLY A 72 ? PRO A 78 ? GLY A 72 PRO A 78 AB 4 ALA A 104 ? GLY A 111 ? ALA A 104 GLY A 111 AB 5 PHE A 140 ? VAL A 143 ? PHE A 140 VAL A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N GLN A 36 ? N GLN A 36 O TYR A 3 ? O TYR A 3 AA 2 3 N VAL A 6 ? N VAL A 6 O GLY A 72 ? O GLY A 72 AA 3 4 N LEU A 73 ? N LEU A 73 O ALA A 104 ? O ALA A 104 AA 4 5 N ALA A 105 ? N ALA A 105 O HIS A 135 ? O HIS A 135 AB 1 2 N GLN A 36 ? N GLN A 36 O TYR A 3 ? O TYR A 3 AB 2 3 N VAL A 6 ? N VAL A 6 O GLY A 72 ? O GLY A 72 AB 3 4 N LEU A 73 ? N LEU A 73 O ALA A 104 ? O ALA A 104 AB 4 5 N ALA A 109 ? N ALA A 109 O PHE A 140 ? O PHE A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE FMN A 500' AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE NAD A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 20 SER A 11 ? SER A 11 . ? 1_555 ? 2 AC1 20 SER A 13 ? SER A 13 . ? 1_555 ? 3 AC1 20 SER A 16 ? SER A 16 . ? 1_555 ? 4 AC1 20 THR A 17 ? THR A 17 . ? 1_555 ? 5 AC1 20 THR A 18 ? THR A 18 . ? 1_555 ? 6 AC1 20 PRO A 78 ? PRO A 78 . ? 1_555 ? 7 AC1 20 ILE A 79 ? ILE A 79 . ? 1_555 ? 8 AC1 20 TYR A 80 ? TYR A 80 . ? 1_555 ? 9 AC1 20 LYS A 81 ? LYS A 81 . ? 1_555 ? 10 AC1 20 ALA A 82 ? ALA A 82 . ? 1_555 ? 11 AC1 20 ASP A 93 ? ASP A 93 . ? 1_555 ? 12 AC1 20 THR A 110 ? THR A 110 . ? 1_555 ? 13 AC1 20 GLY A 111 ? GLY A 111 . ? 1_555 ? 14 AC1 20 GLY A 112 ? GLY A 112 . ? 1_555 ? 15 AC1 20 SER A 113 ? SER A 113 . ? 1_555 ? 16 AC1 20 HIS A 116 ? HIS A 116 . ? 1_555 ? 17 AC1 20 GLN A 144 ? GLN A 144 . ? 1_555 ? 18 AC1 20 NAD C . ? NAD A 501 . ? 1_555 ? 19 AC1 20 HOH D . ? HOH A 2064 . ? 1_555 ? 20 AC1 20 HOH D . ? HOH A 2126 . ? 1_555 ? 21 AC2 11 SER A 13 ? SER A 13 . ? 1_555 ? 22 AC2 11 ARG A 14 ? ARG A 14 . ? 1_555 ? 23 AC2 11 ASN A 15 ? ASN A 15 . ? 1_555 ? 24 AC2 11 LYS A 81 ? LYS A 81 . ? 1_555 ? 25 AC2 11 GLN A 97 ? GLN A 97 . ? 1_555 ? 26 AC2 11 GLY A 112 ? GLY A 112 . ? 1_555 ? 27 AC2 11 GLN A 144 ? GLN A 144 . ? 1_555 ? 28 AC2 11 FMN B . ? FMN A 500 . ? 1_555 ? 29 AC2 11 HOH D . ? HOH A 2004 . ? 1_555 ? 30 AC2 11 HOH D . ? HOH A 2009 . ? 1_555 ? 31 AC2 11 HOH D . ? HOH A 2126 . ? 1_555 ? # _database_PDB_matrix.entry_id 2VZJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2VZJ _atom_sites.fract_transf_matrix[1][1] 0.009883 _atom_sites.fract_transf_matrix[1][2] 0.005706 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011412 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007710 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 PHE 140 140 140 PHE PHE A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 SER 148 148 ? ? ? A . n A 1 149 VAL 149 149 ? ? ? A . n A 1 150 VAL 150 150 ? ? ? A . n A 1 151 ASP 151 151 ? ? ? A . n A 1 152 GLY 152 152 ? ? ? A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 THR 194 194 ? ? ? A . n A 1 195 ARG 195 195 ? ? ? A . n A 1 196 ALA 196 196 ? ? ? A . n A 1 197 ALA 197 197 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FMN 1 500 500 FMN FMN A . C 3 NAD 1 501 501 NAD NAD A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11360 ? 1 MORE -71.4 ? 1 'SSA (A^2)' 32220 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 3 'crystal symmetry operation' 4_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 101.1800000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 11_655 -x+y+1,y,-z -1.0000000000 0.0000000000 0.0000000000 101.1800000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2077 ? D HOH . 2 1 A HOH 2083 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-12 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2013-08-07 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 4 'Structure model' repository Obsolete ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _software.name X-PLOR _software.classification refinement _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # _pdbx_database_remark.id 700 _pdbx_database_remark.text ; SHEET THE SHEET STRUCTURE OF THIS MOLECULE IS BIFURCATED. IN ORDER TO REPRESENT THIS FEATURE IN THE SHEET RECORDS BELOW, TWO SHEETS ARE DEFINED. ; # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 NE2 A HIS 28 ? ? CD2 A HIS 28 ? ? 1.303 1.373 -0.070 0.011 N 2 1 NE2 A HIS 39 ? ? CD2 A HIS 39 ? ? 1.305 1.373 -0.068 0.011 N 3 1 NE2 A HIS 116 ? ? CD2 A HIS 116 ? ? 1.303 1.373 -0.070 0.011 N 4 1 NE2 A HIS 186 ? ? CD2 A HIS 186 ? ? 1.302 1.373 -0.071 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A SER 13 ? ? C A SER 13 ? ? N A ARG 14 ? ? 103.58 117.20 -13.62 2.20 Y 2 1 CB A ARG 38 ? ? CG A ARG 38 ? ? CD A ARG 38 ? ? 94.90 111.60 -16.70 2.60 N 3 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 124.99 120.30 4.69 0.50 N 4 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH2 A ARG 38 ? ? 115.46 120.30 -4.84 0.50 N 5 1 CB A ILE 43 ? ? CA A ILE 43 ? ? C A ILE 43 ? ? 97.04 111.60 -14.56 2.00 N 6 1 NE A ARG 52 ? ? CZ A ARG 52 ? ? NH1 A ARG 52 ? ? 116.88 120.30 -3.42 0.50 N 7 1 CA A LYS 59 ? ? CB A LYS 59 ? ? CG A LYS 59 ? ? 128.11 113.40 14.71 2.20 N 8 1 N A THR 85 ? ? CA A THR 85 ? ? CB A THR 85 ? ? 97.12 110.30 -13.18 1.90 N 9 1 CB A VAL 133 ? ? CA A VAL 133 ? ? C A VAL 133 ? ? 97.48 111.40 -13.92 1.90 N 10 1 CA A LEU 142 ? ? CB A LEU 142 ? ? CG A LEU 142 ? ? 133.16 115.30 17.86 2.30 N 11 1 CD1 A LEU 142 ? ? CG A LEU 142 ? ? CD2 A LEU 142 ? ? 82.14 110.50 -28.36 3.00 N 12 1 CA A LEU 154 ? ? C A LEU 154 ? ? N A ALA 155 ? ? 97.60 117.20 -19.60 2.20 Y 13 1 NE A ARG 172 ? ? CZ A ARG 172 ? ? NH1 A ARG 172 ? ? 116.82 120.30 -3.48 0.50 N 14 1 NE A ARG 172 ? ? CZ A ARG 172 ? ? NH2 A ARG 172 ? ? 123.32 120.30 3.02 0.50 N 15 1 CA A SER 176 ? ? C A SER 176 ? ? N A SER 177 ? ? 97.45 117.20 -19.75 2.20 Y 16 1 O A SER 176 ? ? C A SER 176 ? ? N A SER 177 ? ? 133.67 122.70 10.97 1.60 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 96 ? ? -46.25 160.28 2 1 VAL A 137 ? ? -77.40 -167.50 3 1 SER A 145 ? ? 99.31 59.31 4 1 GLN A 146 ? ? 152.28 33.80 5 1 ALA A 155 ? ? 160.79 -27.19 6 1 SER A 190 ? ? -152.32 -41.87 7 1 ASP A 192 ? ? 156.43 -157.37 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 145 ? CB ? A SER 145 CB 2 1 Y 1 A SER 145 ? OG ? A SER 145 OG 3 1 Y 1 A GLN 146 ? CB ? A GLN 146 CB 4 1 Y 1 A GLN 146 ? CG ? A GLN 146 CG 5 1 Y 1 A GLN 146 ? CD ? A GLN 146 CD 6 1 Y 1 A GLN 146 ? OE1 ? A GLN 146 OE1 7 1 Y 1 A GLN 146 ? NE2 ? A GLN 146 NE2 8 1 Y 1 A PHE 147 ? CB ? A PHE 147 CB 9 1 Y 1 A PHE 147 ? CG ? A PHE 147 CG 10 1 Y 1 A PHE 147 ? CD1 ? A PHE 147 CD1 11 1 Y 1 A PHE 147 ? CD2 ? A PHE 147 CD2 12 1 Y 1 A PHE 147 ? CE1 ? A PHE 147 CE1 13 1 Y 1 A PHE 147 ? CE2 ? A PHE 147 CE2 14 1 Y 1 A PHE 147 ? CZ ? A PHE 147 CZ 15 1 Y 1 A LEU 191 ? CB ? A LEU 191 CB 16 1 Y 1 A LEU 191 ? CG ? A LEU 191 CG 17 1 Y 1 A LEU 191 ? CD1 ? A LEU 191 CD1 18 1 Y 1 A LEU 191 ? CD2 ? A LEU 191 CD2 19 1 Y 1 A ASP 192 ? CB ? A ASP 192 CB 20 1 Y 1 A ASP 192 ? CG ? A ASP 192 CG 21 1 Y 1 A ASP 192 ? OD1 ? A ASP 192 OD1 22 1 Y 1 A ASP 192 ? OD2 ? A ASP 192 OD2 23 1 Y 1 A ALA 193 ? CB ? A ALA 193 CB # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 148 ? A SER 148 3 1 Y 1 A VAL 149 ? A VAL 149 4 1 Y 1 A VAL 150 ? A VAL 150 5 1 Y 1 A ASP 151 ? A ASP 151 6 1 Y 1 A GLY 152 ? A GLY 152 7 1 Y 1 A THR 194 ? A THR 194 8 1 Y 1 A ARG 195 ? A ARG 195 9 1 Y 1 A ALA 196 ? A ALA 196 10 1 Y 1 A ALA 197 ? A ALA 197 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FLAVIN MONONUCLEOTIDE' FMN 3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 4 water HOH #