data_2W1C # _entry.id 2W1C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2W1C PDBE EBI-37840 WWPDB D_1290037840 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1MUO unspecified 'CRYSTAL STRUCTURE OF AURORA-2, AN ONCOGENIC SERINE-THREONINE KINASE' PDB 2J50 unspecified 'STRUCTURE OF AURORA-2 IN COMPLEX WITH PHA -739358' PDB 1OL7 unspecified 'STRUCTURE OF HUMAN AURORA-A 122-403 PHOSPHORYLATED ON THR287, THR288' PDB 1OL6 unspecified 'STRUCTURE OF UNPHOSPHORYLATED D274N MUTANT OF AURORA-A' PDB 2BMC unspecified 'AURORA-2 T287D T288D COMPLEXED WITH PHA- 680632' PDB 2C6E unspecified 'AURORA A KINASE ACTIVATED MUTANT (T287D) IN COMPLEX WITH A 5-AMINOPYRIMIDINYL QUINAZOLINE INHIBITOR' PDB 2J4Z unspecified 'STRUCTURE OF AURORA-2 IN COMPLEX WITH PHA -680626' PDB 1OL5 unspecified 'STRUCTURE OF AURORA-A 122-403, PHOSPHORYLATED ON THR287, THR288 AND BOUND TO TPX2 1-43' PDB 2C6D unspecified 'AURORA A KINASE ACTIVATED MUTANT (T287D) IN COMPLEX WITH ADPNP' PDB 1MQ4 unspecified 'CRYSTAL STRUCTURE OF AURORA-A PROTEIN KINASE' PDB 2W1G unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2W1F unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2W1I unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2W1D unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2W1H unspecified 'FRAGMENT-BASED DISCOVERY OF THE PYRAZOL-4- YL UREA (AT9283), A MULTI-TARGETED KINASE INHIBITOR WITH POTENT AURORA KINASE ACTIVITY' PDB 2W1E unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2W1C _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-10-17 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Howard, S.' 1 'Berdini, V.' 2 'Boulstridge, J.A.' 3 'Carr, M.G.' 4 'Cross, D.M.' 5 'Curry, J.' 6 'Devine, L.A.' 7 'Early, T.R.' 8 'Fazal, L.' 9 'Gill, A.L.' 10 'Heathcote, M.' 11 'Maman, S.' 12 'Matthews, J.E.' 13 'McMenamin, R.L.' 14 'Navarro, E.F.' 15 ;O'Brien, M.A. ; 16 ;O'Reilly, M. ; 17 'Rees, D.C.' 18 'Reule, M.' 19 'Tisi, D.' 20 'Williams, G.' 21 'Vinkovic, M.' 22 'Wyatt, P.G.' 23 # _citation.id primary _citation.title 'Fragment-Based Discovery of the Pyrazol-4-Yl Urea (at9283), a Multitargeted Kinase Inhibitor with Potent Aurora Kinase Activity.' _citation.journal_abbrev J.Med.Chem. _citation.journal_volume 52 _citation.page_first 379 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM JMCMAR _citation.country US _citation.journal_id_ISSN 0022-2623 _citation.journal_id_CSD 0151 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19143567 _citation.pdbx_database_id_DOI 10.1021/JM800984V # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Howard, S.' 1 primary 'Berdini, V.' 2 primary 'Boulstridge, J.A.' 3 primary 'Carr, M.G.' 4 primary 'Cross, D.M.' 5 primary 'Curry, J.' 6 primary 'Devine, L.A.' 7 primary 'Early, T.R.' 8 primary 'Fazal, L.' 9 primary 'Gill, A.L.' 10 primary 'Heathcote, M.' 11 primary 'Maman, S.' 12 primary 'Matthews, J.E.' 13 primary 'Mcmenamin, R.L.' 14 primary 'Navarro, E.F.' 15 primary ;O'Brien, M.A. ; 16 primary ;O'Reilly, M. ; 17 primary 'Rees, D.C.' 18 primary 'Reule, M.' 19 primary 'Tisi, D.' 20 primary 'Williams, G.' 21 primary 'Vinkovic, M.' 22 primary 'Wyatt, P.G.' 23 # _cell.entry_id 2W1C _cell.length_a 82.864 _cell.length_b 82.864 _cell.length_c 168.193 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2W1C _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SERINE/THREONINE-PROTEIN KINASE 6' 32317.898 1 2.7.11.1 ? 'KINASE DOMAIN, RESIDUES 122-389' ? 2 non-polymer syn '4-{[2-(4-{[(4-FLUOROPHENYL)CARBONYL]AMINO}-1H-PYRAZOL-3-YL)-1H-BENZIMIDAZOL-6-YL]METHYL}MORPHOLIN-4-IUM' 421.447 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;AURORA KINASE A, SERINE/THREONINE KINASE 15, AURORA/IPL1-RELATED KINASE 1, BREAST TUMOR-AMPLIFIED KINASE, AURORA A, AURORA-A, AURORA-RELATED KINASE 1, HARK1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF HDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH APSSRR(TPO)(TPO)LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFV TEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF HDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH APSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI SRLLKHNPSQRPMLREVLEHPWITANSSKHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 SER n 1 4 LYS n 1 5 LYS n 1 6 ARG n 1 7 GLN n 1 8 TRP n 1 9 ALA n 1 10 LEU n 1 11 GLU n 1 12 ASP n 1 13 PHE n 1 14 GLU n 1 15 ILE n 1 16 GLY n 1 17 ARG n 1 18 PRO n 1 19 LEU n 1 20 GLY n 1 21 LYS n 1 22 GLY n 1 23 LYS n 1 24 PHE n 1 25 GLY n 1 26 ASN n 1 27 VAL n 1 28 TYR n 1 29 LEU n 1 30 ALA n 1 31 ARG n 1 32 GLU n 1 33 LYS n 1 34 GLN n 1 35 SER n 1 36 LYS n 1 37 PHE n 1 38 ILE n 1 39 LEU n 1 40 ALA n 1 41 LEU n 1 42 LYS n 1 43 VAL n 1 44 LEU n 1 45 PHE n 1 46 LYS n 1 47 ALA n 1 48 GLN n 1 49 LEU n 1 50 GLU n 1 51 LYS n 1 52 ALA n 1 53 GLY n 1 54 VAL n 1 55 GLU n 1 56 HIS n 1 57 GLN n 1 58 LEU n 1 59 ARG n 1 60 ARG n 1 61 GLU n 1 62 VAL n 1 63 GLU n 1 64 ILE n 1 65 GLN n 1 66 SER n 1 67 HIS n 1 68 LEU n 1 69 ARG n 1 70 HIS n 1 71 PRO n 1 72 ASN n 1 73 ILE n 1 74 LEU n 1 75 ARG n 1 76 LEU n 1 77 TYR n 1 78 GLY n 1 79 TYR n 1 80 PHE n 1 81 HIS n 1 82 ASP n 1 83 ALA n 1 84 THR n 1 85 ARG n 1 86 VAL n 1 87 TYR n 1 88 LEU n 1 89 ILE n 1 90 LEU n 1 91 GLU n 1 92 TYR n 1 93 ALA n 1 94 PRO n 1 95 LEU n 1 96 GLY n 1 97 THR n 1 98 VAL n 1 99 TYR n 1 100 ARG n 1 101 GLU n 1 102 LEU n 1 103 GLN n 1 104 LYS n 1 105 LEU n 1 106 SER n 1 107 LYS n 1 108 PHE n 1 109 ASP n 1 110 GLU n 1 111 GLN n 1 112 ARG n 1 113 THR n 1 114 ALA n 1 115 THR n 1 116 TYR n 1 117 ILE n 1 118 THR n 1 119 GLU n 1 120 LEU n 1 121 ALA n 1 122 ASN n 1 123 ALA n 1 124 LEU n 1 125 SER n 1 126 TYR n 1 127 CYS n 1 128 HIS n 1 129 SER n 1 130 LYS n 1 131 ARG n 1 132 VAL n 1 133 ILE n 1 134 HIS n 1 135 ARG n 1 136 ASP n 1 137 ILE n 1 138 LYS n 1 139 PRO n 1 140 GLU n 1 141 ASN n 1 142 LEU n 1 143 LEU n 1 144 LEU n 1 145 GLY n 1 146 SER n 1 147 ALA n 1 148 GLY n 1 149 GLU n 1 150 LEU n 1 151 LYS n 1 152 ILE n 1 153 ALA n 1 154 ASP n 1 155 PHE n 1 156 GLY n 1 157 TRP n 1 158 SER n 1 159 VAL n 1 160 HIS n 1 161 ALA n 1 162 PRO n 1 163 SER n 1 164 SER n 1 165 ARG n 1 166 ARG n 1 167 TPO n 1 168 TPO n 1 169 LEU n 1 170 CYS n 1 171 GLY n 1 172 THR n 1 173 LEU n 1 174 ASP n 1 175 TYR n 1 176 LEU n 1 177 PRO n 1 178 PRO n 1 179 GLU n 1 180 MET n 1 181 ILE n 1 182 GLU n 1 183 GLY n 1 184 ARG n 1 185 MET n 1 186 HIS n 1 187 ASP n 1 188 GLU n 1 189 LYS n 1 190 VAL n 1 191 ASP n 1 192 LEU n 1 193 TRP n 1 194 SER n 1 195 LEU n 1 196 GLY n 1 197 VAL n 1 198 LEU n 1 199 CYS n 1 200 TYR n 1 201 GLU n 1 202 PHE n 1 203 LEU n 1 204 VAL n 1 205 GLY n 1 206 LYS n 1 207 PRO n 1 208 PRO n 1 209 PHE n 1 210 GLU n 1 211 ALA n 1 212 ASN n 1 213 THR n 1 214 TYR n 1 215 GLN n 1 216 GLU n 1 217 THR n 1 218 TYR n 1 219 LYS n 1 220 ARG n 1 221 ILE n 1 222 SER n 1 223 ARG n 1 224 VAL n 1 225 GLU n 1 226 PHE n 1 227 THR n 1 228 PHE n 1 229 PRO n 1 230 ASP n 1 231 PHE n 1 232 VAL n 1 233 THR n 1 234 GLU n 1 235 GLY n 1 236 ALA n 1 237 ARG n 1 238 ASP n 1 239 LEU n 1 240 ILE n 1 241 SER n 1 242 ARG n 1 243 LEU n 1 244 LEU n 1 245 LYS n 1 246 HIS n 1 247 ASN n 1 248 PRO n 1 249 SER n 1 250 GLN n 1 251 ARG n 1 252 PRO n 1 253 MET n 1 254 LEU n 1 255 ARG n 1 256 GLU n 1 257 VAL n 1 258 LEU n 1 259 GLU n 1 260 HIS n 1 261 PRO n 1 262 TRP n 1 263 ILE n 1 264 THR n 1 265 ALA n 1 266 ASN n 1 267 SER n 1 268 SER n 1 269 LYS n 1 270 HIS n 1 271 HIS n 1 272 HIS n 1 273 HIS n 1 274 HIS n 1 275 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET 23A' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2W1C 1 ? ? 2W1C ? 2 UNP STK6_HUMAN 1 ? ? O14965 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2W1C A 1 ? 1 ? 2W1C 121 ? 121 ? 121 121 2 2 2W1C A 2 ? 269 ? O14965 122 ? 389 ? 122 389 3 1 2W1C A 270 ? 275 ? 2W1C 390 ? 395 ? 390 395 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 L0C non-polymer . '4-{[2-(4-{[(4-FLUOROPHENYL)CARBONYL]AMINO}-1H-PYRAZOL-3-YL)-1H-BENZIMIDAZOL-6-YL]METHYL}MORPHOLIN-4-IUM' ? 'C22 H22 F N6 O2 1' 421.447 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2W1C _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.72 _exptl_crystal.density_percent_sol 54.42 _exptl_crystal.description NONE # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.91 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.91 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2W1C _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 54.50 _reflns.d_resolution_high 3.24 _reflns.number_obs 5301 _reflns.number_all ? _reflns.percent_possible_obs 94.7 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 3.40 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.9 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2W1C _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 5301 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 54.59 _refine.ls_d_res_high 3.24 _refine.ls_percent_reflns_obs 94.7 _refine.ls_R_factor_obs 0.246 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.244 _refine.ls_R_factor_R_free 0.288 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 283 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.913 _refine.correlation_coeff_Fo_to_Fc_free 0.837 _refine.B_iso_mean 71.78 _refine.aniso_B[1][1] -0.12000 _refine.aniso_B[2][2] -0.12000 _refine.aniso_B[3][3] 0.17000 _refine.aniso_B[1][2] -0.06000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct OTHER _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.621 _refine.overall_SU_ML 0.469 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 27.545 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2158 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2189 _refine_hist.d_res_high 3.24 _refine_hist.d_res_low 54.59 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.022 ? 2247 'X-RAY DIFFRACTION' ? r_bond_other_d 0.003 0.020 ? 1576 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.315 1.965 ? 3044 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.164 2.979 ? 3803 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.880 5.000 ? 262 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.368 22.691 ? 110 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 17.250 15.038 ? 395 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.959 15.000 ? 20 'X-RAY DIFFRACTION' ? r_chiral_restr 0.061 0.200 ? 317 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.021 ? 2456 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 488 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.958 5.000 ? 1313 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 3.424 6.000 ? 2118 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.993 6.000 ? 934 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.332 7.500 ? 926 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 3.24 _refine_ls_shell.d_res_low 3.33 _refine_ls_shell.number_reflns_R_work 383 _refine_ls_shell.R_factor_R_work 0.2880 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3030 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2W1C _struct.title 'Structure determination of Aurora Kinase in complex with inhibitor' _struct.pdbx_descriptor 'SERINE/THREONINE-PROTEIN KINASE 6 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2W1C _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;CANCER, AURORA, KINASE, INHIBITOR, NUCLEOTIDE-BINDING, SERINE/THREONINE-PROTEIN KINASE, TRANSFERASE, ATP-BINDING, POLYMORPHISM, PHOSPHOPROTEIN, CELL CYCLE ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 9 ? GLU A 11 ? ALA A 129 GLU A 131 5 ? 3 HELX_P HELX_P2 2 LYS A 46 ? ALA A 52 ? LYS A 166 ALA A 172 1 ? 7 HELX_P HELX_P3 3 VAL A 54 ? HIS A 67 ? VAL A 174 HIS A 187 1 ? 14 HELX_P HELX_P4 4 THR A 97 ? SER A 106 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P5 5 ASP A 109 ? SER A 129 ? ASP A 229 SER A 249 1 ? 21 HELX_P HELX_P6 6 LYS A 138 ? GLU A 140 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P7 7 PRO A 177 ? GLY A 183 ? PRO A 297 GLY A 303 1 ? 7 HELX_P HELX_P8 8 LYS A 189 ? GLY A 205 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P9 9 THR A 213 ? ARG A 223 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P10 10 THR A 233 ? LEU A 244 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 11 ASN A 247 ? ARG A 251 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P12 12 MET A 253 ? HIS A 260 ? MET A 373 HIS A 380 1 ? 8 HELX_P HELX_P13 13 HIS A 260 ? SER A 267 ? HIS A 380 SER A 387 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ARG 166 C ? ? ? 1_555 A TPO 167 N ? ? A ARG 286 A TPO 287 1_555 ? ? ? ? ? ? ? 1.327 ? covale2 covale ? ? A TPO 167 C ? ? ? 1_555 A TPO 168 N ? ? A TPO 287 A TPO 288 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A TPO 168 C ? ? ? 1_555 A LEU 169 N ? ? A TPO 288 A LEU 289 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 2 ? AC ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 13 ? GLY A 20 ? PHE A 133 GLY A 140 AA 2 VAL A 27 ? GLU A 32 ? VAL A 147 GLU A 152 AA 3 ILE A 38 ? PHE A 45 ? ILE A 158 PHE A 165 AA 4 ARG A 85 ? LEU A 90 ? ARG A 205 LEU A 210 AA 5 LEU A 76 ? HIS A 81 ? LEU A 196 HIS A 201 AB 1 VAL A 132 ? ILE A 133 ? VAL A 252 ILE A 253 AB 2 VAL A 159 ? HIS A 160 ? VAL A 279 HIS A 280 AC 1 LEU A 142 ? LEU A 144 ? LEU A 262 LEU A 264 AC 2 LEU A 150 ? ILE A 152 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 19 ? N LEU A 139 O VAL A 27 ? O VAL A 147 AA 2 3 N ALA A 30 ? N ALA A 150 O LEU A 39 ? O LEU A 159 AA 3 4 N LEU A 44 ? N LEU A 164 O VAL A 86 ? O VAL A 206 AA 4 5 O ILE A 89 ? O ILE A 209 N TYR A 77 ? N TYR A 197 AB 1 2 N ILE A 133 ? N ILE A 253 O VAL A 159 ? O VAL A 279 AC 1 2 N LEU A 143 ? N LEU A 263 O LYS A 151 ? O LYS A 271 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 11 _struct_site.details 'BINDING SITE FOR RESIDUE L0C A 1391' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 11 ARG A 17 ? ARG A 137 . ? 1_555 ? 2 AC1 11 LYS A 21 ? LYS A 141 . ? 1_555 ? 3 AC1 11 VAL A 27 ? VAL A 147 . ? 1_555 ? 4 AC1 11 LEU A 74 ? LEU A 194 . ? 1_555 ? 5 AC1 11 GLU A 91 ? GLU A 211 . ? 1_555 ? 6 AC1 11 TYR A 92 ? TYR A 212 . ? 1_555 ? 7 AC1 11 ALA A 93 ? ALA A 213 . ? 1_555 ? 8 AC1 11 PRO A 94 ? PRO A 214 . ? 1_555 ? 9 AC1 11 GLY A 96 ? GLY A 216 . ? 1_555 ? 10 AC1 11 LEU A 143 ? LEU A 263 . ? 1_555 ? 11 AC1 11 HIS A 246 ? HIS A 366 . ? 8_565 ? # _database_PDB_matrix.entry_id 2W1C _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2W1C _atom_sites.fract_transf_matrix[1][1] 0.012068 _atom_sites.fract_transf_matrix[1][2] 0.006967 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013935 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005946 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 121 ? ? ? A . n A 1 2 GLU 2 122 ? ? ? A . n A 1 3 SER 3 123 ? ? ? A . n A 1 4 LYS 4 124 ? ? ? A . n A 1 5 LYS 5 125 ? ? ? A . n A 1 6 ARG 6 126 ? ? ? A . n A 1 7 GLN 7 127 127 GLN GLN A . n A 1 8 TRP 8 128 128 TRP TRP A . n A 1 9 ALA 9 129 129 ALA ALA A . n A 1 10 LEU 10 130 130 LEU LEU A . n A 1 11 GLU 11 131 131 GLU GLU A . n A 1 12 ASP 12 132 132 ASP ASP A . n A 1 13 PHE 13 133 133 PHE PHE A . n A 1 14 GLU 14 134 134 GLU GLU A . n A 1 15 ILE 15 135 135 ILE ILE A . n A 1 16 GLY 16 136 136 GLY GLY A . n A 1 17 ARG 17 137 137 ARG ARG A . n A 1 18 PRO 18 138 138 PRO PRO A . n A 1 19 LEU 19 139 139 LEU LEU A . n A 1 20 GLY 20 140 140 GLY GLY A . n A 1 21 LYS 21 141 141 LYS LYS A . n A 1 22 GLY 22 142 142 GLY GLY A . n A 1 23 LYS 23 143 143 LYS LYS A . n A 1 24 PHE 24 144 144 PHE PHE A . n A 1 25 GLY 25 145 145 GLY GLY A . n A 1 26 ASN 26 146 146 ASN ASN A . n A 1 27 VAL 27 147 147 VAL VAL A . n A 1 28 TYR 28 148 148 TYR TYR A . n A 1 29 LEU 29 149 149 LEU LEU A . n A 1 30 ALA 30 150 150 ALA ALA A . n A 1 31 ARG 31 151 151 ARG ARG A . n A 1 32 GLU 32 152 152 GLU GLU A . n A 1 33 LYS 33 153 153 LYS LYS A . n A 1 34 GLN 34 154 154 GLN GLN A . n A 1 35 SER 35 155 155 SER SER A . n A 1 36 LYS 36 156 156 LYS LYS A . n A 1 37 PHE 37 157 157 PHE PHE A . n A 1 38 ILE 38 158 158 ILE ILE A . n A 1 39 LEU 39 159 159 LEU LEU A . n A 1 40 ALA 40 160 160 ALA ALA A . n A 1 41 LEU 41 161 161 LEU LEU A . n A 1 42 LYS 42 162 162 LYS LYS A . n A 1 43 VAL 43 163 163 VAL VAL A . n A 1 44 LEU 44 164 164 LEU LEU A . n A 1 45 PHE 45 165 165 PHE PHE A . n A 1 46 LYS 46 166 166 LYS LYS A . n A 1 47 ALA 47 167 167 ALA ALA A . n A 1 48 GLN 48 168 168 GLN GLN A . n A 1 49 LEU 49 169 169 LEU LEU A . n A 1 50 GLU 50 170 170 GLU GLU A . n A 1 51 LYS 51 171 171 LYS LYS A . n A 1 52 ALA 52 172 172 ALA ALA A . n A 1 53 GLY 53 173 173 GLY GLY A . n A 1 54 VAL 54 174 174 VAL VAL A . n A 1 55 GLU 55 175 175 GLU GLU A . n A 1 56 HIS 56 176 176 HIS HIS A . n A 1 57 GLN 57 177 177 GLN GLN A . n A 1 58 LEU 58 178 178 LEU LEU A . n A 1 59 ARG 59 179 179 ARG ARG A . n A 1 60 ARG 60 180 180 ARG ARG A . n A 1 61 GLU 61 181 181 GLU GLU A . n A 1 62 VAL 62 182 182 VAL VAL A . n A 1 63 GLU 63 183 183 GLU GLU A . n A 1 64 ILE 64 184 184 ILE ILE A . n A 1 65 GLN 65 185 185 GLN GLN A . n A 1 66 SER 66 186 186 SER SER A . n A 1 67 HIS 67 187 187 HIS HIS A . n A 1 68 LEU 68 188 188 LEU LEU A . n A 1 69 ARG 69 189 189 ARG ARG A . n A 1 70 HIS 70 190 190 HIS HIS A . n A 1 71 PRO 71 191 191 PRO PRO A . n A 1 72 ASN 72 192 192 ASN ASN A . n A 1 73 ILE 73 193 193 ILE ILE A . n A 1 74 LEU 74 194 194 LEU LEU A . n A 1 75 ARG 75 195 195 ARG ARG A . n A 1 76 LEU 76 196 196 LEU LEU A . n A 1 77 TYR 77 197 197 TYR TYR A . n A 1 78 GLY 78 198 198 GLY GLY A . n A 1 79 TYR 79 199 199 TYR TYR A . n A 1 80 PHE 80 200 200 PHE PHE A . n A 1 81 HIS 81 201 201 HIS HIS A . n A 1 82 ASP 82 202 202 ASP ASP A . n A 1 83 ALA 83 203 203 ALA ALA A . n A 1 84 THR 84 204 204 THR THR A . n A 1 85 ARG 85 205 205 ARG ARG A . n A 1 86 VAL 86 206 206 VAL VAL A . n A 1 87 TYR 87 207 207 TYR TYR A . n A 1 88 LEU 88 208 208 LEU LEU A . n A 1 89 ILE 89 209 209 ILE ILE A . n A 1 90 LEU 90 210 210 LEU LEU A . n A 1 91 GLU 91 211 211 GLU GLU A . n A 1 92 TYR 92 212 212 TYR TYR A . n A 1 93 ALA 93 213 213 ALA ALA A . n A 1 94 PRO 94 214 214 PRO PRO A . n A 1 95 LEU 95 215 215 LEU LEU A . n A 1 96 GLY 96 216 216 GLY GLY A . n A 1 97 THR 97 217 217 THR THR A . n A 1 98 VAL 98 218 218 VAL VAL A . n A 1 99 TYR 99 219 219 TYR TYR A . n A 1 100 ARG 100 220 220 ARG ARG A . n A 1 101 GLU 101 221 221 GLU GLU A . n A 1 102 LEU 102 222 222 LEU LEU A . n A 1 103 GLN 103 223 223 GLN GLN A . n A 1 104 LYS 104 224 224 LYS LYS A . n A 1 105 LEU 105 225 225 LEU LEU A . n A 1 106 SER 106 226 226 SER SER A . n A 1 107 LYS 107 227 227 LYS LYS A . n A 1 108 PHE 108 228 228 PHE PHE A . n A 1 109 ASP 109 229 229 ASP ASP A . n A 1 110 GLU 110 230 230 GLU GLU A . n A 1 111 GLN 111 231 231 GLN GLN A . n A 1 112 ARG 112 232 232 ARG ARG A . n A 1 113 THR 113 233 233 THR THR A . n A 1 114 ALA 114 234 234 ALA ALA A . n A 1 115 THR 115 235 235 THR THR A . n A 1 116 TYR 116 236 236 TYR TYR A . n A 1 117 ILE 117 237 237 ILE ILE A . n A 1 118 THR 118 238 238 THR THR A . n A 1 119 GLU 119 239 239 GLU GLU A . n A 1 120 LEU 120 240 240 LEU LEU A . n A 1 121 ALA 121 241 241 ALA ALA A . n A 1 122 ASN 122 242 242 ASN ASN A . n A 1 123 ALA 123 243 243 ALA ALA A . n A 1 124 LEU 124 244 244 LEU LEU A . n A 1 125 SER 125 245 245 SER SER A . n A 1 126 TYR 126 246 246 TYR TYR A . n A 1 127 CYS 127 247 247 CYS CYS A . n A 1 128 HIS 128 248 248 HIS HIS A . n A 1 129 SER 129 249 249 SER SER A . n A 1 130 LYS 130 250 250 LYS LYS A . n A 1 131 ARG 131 251 251 ARG ARG A . n A 1 132 VAL 132 252 252 VAL VAL A . n A 1 133 ILE 133 253 253 ILE ILE A . n A 1 134 HIS 134 254 254 HIS HIS A . n A 1 135 ARG 135 255 255 ARG ARG A . n A 1 136 ASP 136 256 256 ASP ASP A . n A 1 137 ILE 137 257 257 ILE ILE A . n A 1 138 LYS 138 258 258 LYS LYS A . n A 1 139 PRO 139 259 259 PRO PRO A . n A 1 140 GLU 140 260 260 GLU GLU A . n A 1 141 ASN 141 261 261 ASN ASN A . n A 1 142 LEU 142 262 262 LEU LEU A . n A 1 143 LEU 143 263 263 LEU LEU A . n A 1 144 LEU 144 264 264 LEU LEU A . n A 1 145 GLY 145 265 265 GLY GLY A . n A 1 146 SER 146 266 266 SER SER A . n A 1 147 ALA 147 267 267 ALA ALA A . n A 1 148 GLY 148 268 268 GLY GLY A . n A 1 149 GLU 149 269 269 GLU GLU A . n A 1 150 LEU 150 270 270 LEU LEU A . n A 1 151 LYS 151 271 271 LYS LYS A . n A 1 152 ILE 152 272 272 ILE ILE A . n A 1 153 ALA 153 273 273 ALA ALA A . n A 1 154 ASP 154 274 274 ASP ASP A . n A 1 155 PHE 155 275 275 PHE PHE A . n A 1 156 GLY 156 276 276 GLY GLY A . n A 1 157 TRP 157 277 277 TRP TRP A . n A 1 158 SER 158 278 278 SER SER A . n A 1 159 VAL 159 279 279 VAL VAL A . n A 1 160 HIS 160 280 280 HIS HIS A . n A 1 161 ALA 161 281 281 ALA ALA A . n A 1 162 PRO 162 282 282 PRO PRO A . n A 1 163 SER 163 283 283 SER SER A . n A 1 164 SER 164 284 284 SER SER A . n A 1 165 ARG 165 285 285 ARG ARG A . n A 1 166 ARG 166 286 286 ARG ARG A . n A 1 167 TPO 167 287 287 TPO TPO A . n A 1 168 TPO 168 288 288 TPO TPO A . n A 1 169 LEU 169 289 289 LEU LEU A . n A 1 170 CYS 170 290 290 CYS CYS A . n A 1 171 GLY 171 291 291 GLY GLY A . n A 1 172 THR 172 292 292 THR THR A . n A 1 173 LEU 173 293 293 LEU LEU A . n A 1 174 ASP 174 294 294 ASP ASP A . n A 1 175 TYR 175 295 295 TYR TYR A . n A 1 176 LEU 176 296 296 LEU LEU A . n A 1 177 PRO 177 297 297 PRO PRO A . n A 1 178 PRO 178 298 298 PRO PRO A . n A 1 179 GLU 179 299 299 GLU GLU A . n A 1 180 MET 180 300 300 MET MET A . n A 1 181 ILE 181 301 301 ILE ILE A . n A 1 182 GLU 182 302 302 GLU GLU A . n A 1 183 GLY 183 303 303 GLY GLY A . n A 1 184 ARG 184 304 304 ARG ARG A . n A 1 185 MET 185 305 305 MET MET A . n A 1 186 HIS 186 306 306 HIS HIS A . n A 1 187 ASP 187 307 307 ASP ASP A . n A 1 188 GLU 188 308 308 GLU GLU A . n A 1 189 LYS 189 309 309 LYS LYS A . n A 1 190 VAL 190 310 310 VAL VAL A . n A 1 191 ASP 191 311 311 ASP ASP A . n A 1 192 LEU 192 312 312 LEU LEU A . n A 1 193 TRP 193 313 313 TRP TRP A . n A 1 194 SER 194 314 314 SER SER A . n A 1 195 LEU 195 315 315 LEU LEU A . n A 1 196 GLY 196 316 316 GLY GLY A . n A 1 197 VAL 197 317 317 VAL VAL A . n A 1 198 LEU 198 318 318 LEU LEU A . n A 1 199 CYS 199 319 319 CYS CYS A . n A 1 200 TYR 200 320 320 TYR TYR A . n A 1 201 GLU 201 321 321 GLU GLU A . n A 1 202 PHE 202 322 322 PHE PHE A . n A 1 203 LEU 203 323 323 LEU LEU A . n A 1 204 VAL 204 324 324 VAL VAL A . n A 1 205 GLY 205 325 325 GLY GLY A . n A 1 206 LYS 206 326 326 LYS LYS A . n A 1 207 PRO 207 327 327 PRO PRO A . n A 1 208 PRO 208 328 328 PRO PRO A . n A 1 209 PHE 209 329 329 PHE PHE A . n A 1 210 GLU 210 330 330 GLU GLU A . n A 1 211 ALA 211 331 331 ALA ALA A . n A 1 212 ASN 212 332 332 ASN ASN A . n A 1 213 THR 213 333 333 THR THR A . n A 1 214 TYR 214 334 334 TYR TYR A . n A 1 215 GLN 215 335 335 GLN GLN A . n A 1 216 GLU 216 336 336 GLU GLU A . n A 1 217 THR 217 337 337 THR THR A . n A 1 218 TYR 218 338 338 TYR TYR A . n A 1 219 LYS 219 339 339 LYS LYS A . n A 1 220 ARG 220 340 340 ARG ARG A . n A 1 221 ILE 221 341 341 ILE ILE A . n A 1 222 SER 222 342 342 SER SER A . n A 1 223 ARG 223 343 343 ARG ARG A . n A 1 224 VAL 224 344 344 VAL VAL A . n A 1 225 GLU 225 345 345 GLU GLU A . n A 1 226 PHE 226 346 346 PHE PHE A . n A 1 227 THR 227 347 347 THR THR A . n A 1 228 PHE 228 348 348 PHE PHE A . n A 1 229 PRO 229 349 349 PRO PRO A . n A 1 230 ASP 230 350 350 ASP ASP A . n A 1 231 PHE 231 351 351 PHE PHE A . n A 1 232 VAL 232 352 352 VAL VAL A . n A 1 233 THR 233 353 353 THR THR A . n A 1 234 GLU 234 354 354 GLU GLU A . n A 1 235 GLY 235 355 355 GLY GLY A . n A 1 236 ALA 236 356 356 ALA ALA A . n A 1 237 ARG 237 357 357 ARG ARG A . n A 1 238 ASP 238 358 358 ASP ASP A . n A 1 239 LEU 239 359 359 LEU LEU A . n A 1 240 ILE 240 360 360 ILE ILE A . n A 1 241 SER 241 361 361 SER SER A . n A 1 242 ARG 242 362 362 ARG ARG A . n A 1 243 LEU 243 363 363 LEU LEU A . n A 1 244 LEU 244 364 364 LEU LEU A . n A 1 245 LYS 245 365 365 LYS LYS A . n A 1 246 HIS 246 366 366 HIS HIS A . n A 1 247 ASN 247 367 367 ASN ASN A . n A 1 248 PRO 248 368 368 PRO PRO A . n A 1 249 SER 249 369 369 SER SER A . n A 1 250 GLN 250 370 370 GLN GLN A . n A 1 251 ARG 251 371 371 ARG ARG A . n A 1 252 PRO 252 372 372 PRO PRO A . n A 1 253 MET 253 373 373 MET MET A . n A 1 254 LEU 254 374 374 LEU LEU A . n A 1 255 ARG 255 375 375 ARG ARG A . n A 1 256 GLU 256 376 376 GLU GLU A . n A 1 257 VAL 257 377 377 VAL VAL A . n A 1 258 LEU 258 378 378 LEU LEU A . n A 1 259 GLU 259 379 379 GLU GLU A . n A 1 260 HIS 260 380 380 HIS HIS A . n A 1 261 PRO 261 381 381 PRO PRO A . n A 1 262 TRP 262 382 382 TRP TRP A . n A 1 263 ILE 263 383 383 ILE ILE A . n A 1 264 THR 264 384 384 THR THR A . n A 1 265 ALA 265 385 385 ALA ALA A . n A 1 266 ASN 266 386 386 ASN ASN A . n A 1 267 SER 267 387 387 SER SER A . n A 1 268 SER 268 388 388 SER SER A . n A 1 269 LYS 269 389 389 LYS LYS A . n A 1 270 HIS 270 390 390 HIS HIS A . n A 1 271 HIS 271 391 ? ? ? A . n A 1 272 HIS 272 392 ? ? ? A . n A 1 273 HIS 273 393 ? ? ? A . n A 1 274 HIS 274 394 ? ? ? A . n A 1 275 HIS 275 395 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id L0C _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1391 _pdbx_nonpoly_scheme.auth_seq_num 1391 _pdbx_nonpoly_scheme.pdb_mon_id L0C _pdbx_nonpoly_scheme.auth_mon_id L0C _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 167 A TPO 287 ? THR PHOSPHOTHREONINE 2 A TPO 168 A TPO 288 ? THR PHOSPHOTHREONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-01-27 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # _software.name REFMAC _software.classification refinement _software.version 5.4.0069A _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 141 ? ? -128.99 -162.56 2 1 ALA A 167 ? ? -17.90 -67.93 3 1 PHE A 200 ? ? 179.84 179.57 4 1 ASP A 202 ? ? -134.65 -125.86 5 1 SER A 226 ? ? 61.52 -50.70 6 1 ARG A 255 ? ? 81.68 -30.47 7 1 ASP A 256 ? ? -109.51 46.80 8 1 ALA A 267 ? ? -59.21 -8.94 9 1 ASP A 274 ? ? 46.97 95.02 10 1 ALA A 281 ? ? 58.29 -174.38 11 1 ARG A 286 ? ? -76.39 32.11 12 1 TPO A 287 ? ? 39.90 -102.54 13 1 TPO A 288 ? ? 49.86 114.79 14 1 CYS A 290 ? ? -60.97 82.12 15 1 ASP A 307 ? ? -112.13 -145.10 16 1 LEU A 364 ? ? -101.11 49.68 17 1 SER A 388 ? ? -37.63 -71.76 18 1 LYS A 389 ? ? -56.30 -129.92 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 289 ? CG ? A LEU 169 CG 2 1 Y 1 A LEU 289 ? CD1 ? A LEU 169 CD1 3 1 Y 1 A LEU 289 ? CD2 ? A LEU 169 CD2 4 1 Y 1 A CYS 290 ? SG ? A CYS 170 SG 5 1 Y 1 A GLU 336 ? CG ? A GLU 216 CG 6 1 Y 1 A GLU 336 ? CD ? A GLU 216 CD 7 1 Y 1 A GLU 336 ? OE1 ? A GLU 216 OE1 8 1 Y 1 A GLU 336 ? OE2 ? A GLU 216 OE2 9 1 Y 1 A HIS 390 ? CA ? A HIS 270 CA 10 1 Y 1 A HIS 390 ? C ? A HIS 270 C 11 1 Y 1 A HIS 390 ? O ? A HIS 270 O 12 1 Y 1 A HIS 390 ? CB ? A HIS 270 CB 13 1 Y 1 A HIS 390 ? CG ? A HIS 270 CG 14 1 Y 1 A HIS 390 ? ND1 ? A HIS 270 ND1 15 1 Y 1 A HIS 390 ? CD2 ? A HIS 270 CD2 16 1 Y 1 A HIS 390 ? CE1 ? A HIS 270 CE1 17 1 Y 1 A HIS 390 ? NE2 ? A HIS 270 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 121 ? A MET 1 2 1 Y 1 A GLU 122 ? A GLU 2 3 1 Y 1 A SER 123 ? A SER 3 4 1 Y 1 A LYS 124 ? A LYS 4 5 1 Y 1 A LYS 125 ? A LYS 5 6 1 Y 1 A ARG 126 ? A ARG 6 7 1 Y 1 A HIS 391 ? A HIS 271 8 1 Y 1 A HIS 392 ? A HIS 272 9 1 Y 1 A HIS 393 ? A HIS 273 10 1 Y 1 A HIS 394 ? A HIS 274 11 1 Y 1 A HIS 395 ? A HIS 275 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '4-{[2-(4-{[(4-FLUOROPHENYL)CARBONYL]AMINO}-1H-PYRAZOL-3-YL)-1H-BENZIMIDAZOL-6-YL]METHYL}MORPHOLIN-4-IUM' _pdbx_entity_nonpoly.comp_id L0C #