data_2W3Q # _entry.id 2W3Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2W3Q PDBE EBI-38108 WWPDB D_1290038108 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2W3N _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'STRUCTURE AND INHIBITION OF THE CO2-SENSING CARBONIC ANHYDRASE CAN2 FROM THE PATHOGENIC FUNGUS CRYPTOCOCCUS NEOFORMANS' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2W3Q _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2008-11-14 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schlicker, C.' 1 'Hall, R.A.' 2 'Vullo, D.' 3 'Middelhaufe, S.' 4 'Gertz, M.' 5 'Supuran, C.T.' 6 'Muehlschlegel, F.A.' 7 'Steegborn, C.' 8 # _citation.id primary _citation.title 'Structure and Inhibition of the Co(2)-Sensing Carbonic Anhydrase Can2 from the Pathogenic Fungus Cryptococcus Neoformans.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 385 _citation.page_first 1207 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19071134 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2008.11.037 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Schlicker, C.' 1 primary 'Hall, R.A.' 2 primary 'Vullo, D.' 3 primary 'Middelhaufe, S.' 4 primary 'Gertz, M.' 5 primary 'Supuran, C.T.' 6 primary 'Muehlschlegel, F.A.' 7 primary 'Steegborn, C.' 8 # _cell.entry_id 2W3Q _cell.length_a 55.190 _cell.length_b 55.190 _cell.length_c 134.590 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2W3Q _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CARBONIC ANHYDRASE 2' 26985.586 1 4.2.1.1 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 4 water nat water 18.015 165 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CARBONIC ANHYDRASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PLGSMPFHAEPLKPSDEIDMDLGHSVAAQKFKEIREVLEGNRYWARKVTSEEPEFMAEQVKGQAPNFLWIGCADSRVPEV TIMARKPGDVFVQRNVANQFKPEDDSSQALLNYAIMNVGVTHVMVVGHTGCGGCIAAFDQPLPTEENPGGTPLVRYLEPI IRLKHSLPEGSDVNDLIKENVKMAVKNVVNSPTIQGAWEQARKGEFREVFVHGWLYDLSTGNIVDLNVTQGPHPFVDDRV PRA ; _entity_poly.pdbx_seq_one_letter_code_can ;PLGSMPFHAEPLKPSDEIDMDLGHSVAAQKFKEIREVLEGNRYWARKVTSEEPEFMAEQVKGQAPNFLWIGCADSRVPEV TIMARKPGDVFVQRNVANQFKPEDDSSQALLNYAIMNVGVTHVMVVGHTGCGGCIAAFDQPLPTEENPGGTPLVRYLEPI IRLKHSLPEGSDVNDLIKENVKMAVKNVVNSPTIQGAWEQARKGEFREVFVHGWLYDLSTGNIVDLNVTQGPHPFVDDRV PRA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LEU n 1 3 GLY n 1 4 SER n 1 5 MET n 1 6 PRO n 1 7 PHE n 1 8 HIS n 1 9 ALA n 1 10 GLU n 1 11 PRO n 1 12 LEU n 1 13 LYS n 1 14 PRO n 1 15 SER n 1 16 ASP n 1 17 GLU n 1 18 ILE n 1 19 ASP n 1 20 MET n 1 21 ASP n 1 22 LEU n 1 23 GLY n 1 24 HIS n 1 25 SER n 1 26 VAL n 1 27 ALA n 1 28 ALA n 1 29 GLN n 1 30 LYS n 1 31 PHE n 1 32 LYS n 1 33 GLU n 1 34 ILE n 1 35 ARG n 1 36 GLU n 1 37 VAL n 1 38 LEU n 1 39 GLU n 1 40 GLY n 1 41 ASN n 1 42 ARG n 1 43 TYR n 1 44 TRP n 1 45 ALA n 1 46 ARG n 1 47 LYS n 1 48 VAL n 1 49 THR n 1 50 SER n 1 51 GLU n 1 52 GLU n 1 53 PRO n 1 54 GLU n 1 55 PHE n 1 56 MET n 1 57 ALA n 1 58 GLU n 1 59 GLN n 1 60 VAL n 1 61 LYS n 1 62 GLY n 1 63 GLN n 1 64 ALA n 1 65 PRO n 1 66 ASN n 1 67 PHE n 1 68 LEU n 1 69 TRP n 1 70 ILE n 1 71 GLY n 1 72 CYS n 1 73 ALA n 1 74 ASP n 1 75 SER n 1 76 ARG n 1 77 VAL n 1 78 PRO n 1 79 GLU n 1 80 VAL n 1 81 THR n 1 82 ILE n 1 83 MET n 1 84 ALA n 1 85 ARG n 1 86 LYS n 1 87 PRO n 1 88 GLY n 1 89 ASP n 1 90 VAL n 1 91 PHE n 1 92 VAL n 1 93 GLN n 1 94 ARG n 1 95 ASN n 1 96 VAL n 1 97 ALA n 1 98 ASN n 1 99 GLN n 1 100 PHE n 1 101 LYS n 1 102 PRO n 1 103 GLU n 1 104 ASP n 1 105 ASP n 1 106 SER n 1 107 SER n 1 108 GLN n 1 109 ALA n 1 110 LEU n 1 111 LEU n 1 112 ASN n 1 113 TYR n 1 114 ALA n 1 115 ILE n 1 116 MET n 1 117 ASN n 1 118 VAL n 1 119 GLY n 1 120 VAL n 1 121 THR n 1 122 HIS n 1 123 VAL n 1 124 MET n 1 125 VAL n 1 126 VAL n 1 127 GLY n 1 128 HIS n 1 129 THR n 1 130 GLY n 1 131 CYS n 1 132 GLY n 1 133 GLY n 1 134 CYS n 1 135 ILE n 1 136 ALA n 1 137 ALA n 1 138 PHE n 1 139 ASP n 1 140 GLN n 1 141 PRO n 1 142 LEU n 1 143 PRO n 1 144 THR n 1 145 GLU n 1 146 GLU n 1 147 ASN n 1 148 PRO n 1 149 GLY n 1 150 GLY n 1 151 THR n 1 152 PRO n 1 153 LEU n 1 154 VAL n 1 155 ARG n 1 156 TYR n 1 157 LEU n 1 158 GLU n 1 159 PRO n 1 160 ILE n 1 161 ILE n 1 162 ARG n 1 163 LEU n 1 164 LYS n 1 165 HIS n 1 166 SER n 1 167 LEU n 1 168 PRO n 1 169 GLU n 1 170 GLY n 1 171 SER n 1 172 ASP n 1 173 VAL n 1 174 ASN n 1 175 ASP n 1 176 LEU n 1 177 ILE n 1 178 LYS n 1 179 GLU n 1 180 ASN n 1 181 VAL n 1 182 LYS n 1 183 MET n 1 184 ALA n 1 185 VAL n 1 186 LYS n 1 187 ASN n 1 188 VAL n 1 189 VAL n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 THR n 1 194 ILE n 1 195 GLN n 1 196 GLY n 1 197 ALA n 1 198 TRP n 1 199 GLU n 1 200 GLN n 1 201 ALA n 1 202 ARG n 1 203 LYS n 1 204 GLY n 1 205 GLU n 1 206 PHE n 1 207 ARG n 1 208 GLU n 1 209 VAL n 1 210 PHE n 1 211 VAL n 1 212 HIS n 1 213 GLY n 1 214 TRP n 1 215 LEU n 1 216 TYR n 1 217 ASP n 1 218 LEU n 1 219 SER n 1 220 THR n 1 221 GLY n 1 222 ASN n 1 223 ILE n 1 224 VAL n 1 225 ASP n 1 226 LEU n 1 227 ASN n 1 228 VAL n 1 229 THR n 1 230 GLN n 1 231 GLY n 1 232 PRO n 1 233 HIS n 1 234 PRO n 1 235 PHE n 1 236 VAL n 1 237 ASP n 1 238 ASP n 1 239 ARG n 1 240 VAL n 1 241 PRO n 1 242 ARG n 1 243 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'CRYPTOCOCCUS NEOFORMANS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5207 _entity_src_gen.pdbx_gene_src_variant GRUBII _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ROSETTA _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PET151 TOPO' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2W3Q 1 ? ? 2W3Q ? 2 UNP Q3I4V7_CRYNV 1 ? ? Q3I4V7 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2W3Q A 1 ? 4 ? 2W3Q -3 ? 0 ? -3 0 2 2 2W3Q A 5 ? 243 ? Q3I4V7 1 ? 239 ? 1 239 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2W3Q _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 44.74 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '20 % PEG3350, 0.2 M NACL, 0.1 M TRIS_HCL PH 8.6' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9789 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_wavelength 0.9789 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2W3Q _reflns.observed_criterion_sigma_I 2.67 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 47.80 _reflns.d_resolution_high 1.34 _reflns.number_obs 54533 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.13 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.43 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 1 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.34 _reflns_shell.d_res_low 1.43 _reflns_shell.percent_possible_all 98.8 _reflns_shell.Rmerge_I_obs 0.35 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.01 _reflns_shell.pdbx_redundancy 0.99 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2W3Q _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all 54510 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.67 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 47.8 _refine.ls_d_res_high 1.34 _refine.ls_percent_reflns_obs 99.8 _refine.ls_R_factor_obs 0.138 _refine.ls_R_factor_all 0.139 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.1846 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5 _refine.ls_number_reflns_R_free 2718 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 1T75' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1766 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 165 _refine_hist.number_atoms_total 1933 _refine_hist.d_res_high 1.34 _refine_hist.d_res_low 47.8 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.01 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.03 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist ? ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes ? ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol ? ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol ? ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr ? ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt ? ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt ? ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps ? ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 2W3Q _pdbx_refine.R_factor_all_no_cutoff 0.139 _pdbx_refine.R_factor_obs_no_cutoff 0.138 _pdbx_refine.free_R_factor_no_cutoff 0.1846 _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 2718 _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff 51635 # _struct.entry_id 2W3Q _struct.title 'Structure and inhibition of the CO2-sensing carbonic anhydrase Can2 from the pathogenic fungus Cryptococcus neoformans' _struct.pdbx_descriptor 'CARBONIC ANHYDRASE 2 (E.C.4.2.1.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2W3Q _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'BETA-CLASS CARBONIC ANHYDRASE, LYASE, INHIBITION, SULFONAMIDE, CRYPTOCOCCUS NEOFORMANS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 13 ? LEU A 22 ? LYS A 9 LEU A 18 1 ? 10 HELX_P HELX_P2 2 SER A 25 ? PHE A 31 ? SER A 21 PHE A 27 1 ? 7 HELX_P HELX_P3 3 PHE A 31 ? GLU A 52 ? PHE A 27 GLU A 48 1 ? 22 HELX_P HELX_P4 4 GLU A 52 ? GLY A 62 ? GLU A 48 GLY A 58 1 ? 11 HELX_P HELX_P5 5 PRO A 78 ? MET A 83 ? PRO A 74 MET A 79 1 ? 6 HELX_P HELX_P6 6 VAL A 96 ? GLN A 99 ? VAL A 92 GLN A 95 5 ? 4 HELX_P HELX_P7 7 ASP A 104 ? ASN A 117 ? ASP A 100 ASN A 113 1 ? 14 HELX_P HELX_P8 8 CYS A 131 ? ASP A 139 ? CYS A 127 ASP A 135 1 ? 9 HELX_P HELX_P9 9 THR A 151 ? LEU A 157 ? THR A 147 LEU A 153 1 ? 7 HELX_P HELX_P10 10 LEU A 157 ? LEU A 167 ? LEU A 153 LEU A 163 1 ? 11 HELX_P HELX_P11 11 ASP A 172 ? ASN A 190 ? ASP A 168 ASN A 186 1 ? 19 HELX_P HELX_P12 12 SER A 191 ? LYS A 203 ? SER A 187 LYS A 199 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 131 SG ? ? A ZN 1231 A CYS 127 1_555 ? ? ? ? ? ? ? 2.323 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 72 SG ? ? A ZN 1231 A CYS 68 1_555 ? ? ? ? ? ? ? 2.264 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 128 NE2 ? ? A ZN 1231 A HIS 124 1_555 ? ? ? ? ? ? ? 2.073 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 1231 A HOH 2165 1_555 ? ? ? ? ? ? ? 2.073 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 90 ? ASN A 95 ? VAL A 86 ASN A 91 AA 2 PHE A 67 ? CYS A 72 ? PHE A 63 CYS A 68 AA 3 HIS A 122 ? HIS A 128 ? HIS A 118 HIS A 124 AA 4 PHE A 210 ? TYR A 216 ? PHE A 206 TYR A 212 AA 5 ILE A 223 ? ASP A 225 ? ILE A 219 ASP A 221 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N PHE A 91 ? N PHE A 87 O PHE A 67 ? O PHE A 63 AA 2 3 N LEU A 68 ? N LEU A 64 O HIS A 122 ? O HIS A 118 AA 3 4 N VAL A 123 ? N VAL A 119 O PHE A 210 ? O PHE A 206 AA 4 5 N LEU A 215 ? N LEU A 211 O VAL A 224 ? O VAL A 220 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A1231' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A1232' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 72 ? CYS A 68 . ? 1_555 ? 2 AC1 4 HIS A 128 ? HIS A 124 . ? 1_555 ? 3 AC1 4 CYS A 131 ? CYS A 127 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 2165 . ? 1_555 ? 5 AC2 4 VAL A 189 ? VAL A 185 . ? 1_555 ? 6 AC2 4 GLN A 230 ? GLN A 226 . ? 1_555 ? 7 AC2 4 HOH D . ? HOH A 2131 . ? 1_555 ? 8 AC2 4 HOH D . ? HOH A 2134 . ? 1_555 ? # _database_PDB_matrix.entry_id 2W3Q _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2W3Q _atom_sites.fract_transf_matrix[1][1] 0.018119 _atom_sites.fract_transf_matrix[1][2] 0.010461 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020922 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007430 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 -3 -3 PRO PRO A . n A 1 2 LEU 2 -2 -2 LEU LEU A . n A 1 3 GLY 3 -1 -1 GLY GLY A . n A 1 4 SER 4 0 0 SER SER A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 PRO 6 2 2 PRO PRO A . n A 1 7 PHE 7 3 3 PHE PHE A . n A 1 8 HIS 8 4 4 HIS HIS A . n A 1 9 ALA 9 5 5 ALA ALA A . n A 1 10 GLU 10 6 6 GLU GLU A . n A 1 11 PRO 11 7 7 PRO PRO A . n A 1 12 LEU 12 8 8 LEU LEU A . n A 1 13 LYS 13 9 9 LYS LYS A . n A 1 14 PRO 14 10 10 PRO PRO A . n A 1 15 SER 15 11 11 SER SER A . n A 1 16 ASP 16 12 12 ASP ASP A . n A 1 17 GLU 17 13 13 GLU GLU A . n A 1 18 ILE 18 14 14 ILE ILE A . n A 1 19 ASP 19 15 15 ASP ASP A . n A 1 20 MET 20 16 16 MET MET A . n A 1 21 ASP 21 17 17 ASP ASP A . n A 1 22 LEU 22 18 18 LEU LEU A . n A 1 23 GLY 23 19 19 GLY GLY A . n A 1 24 HIS 24 20 20 HIS HIS A . n A 1 25 SER 25 21 21 SER SER A . n A 1 26 VAL 26 22 22 VAL VAL A . n A 1 27 ALA 27 23 23 ALA ALA A . n A 1 28 ALA 28 24 24 ALA ALA A . n A 1 29 GLN 29 25 25 GLN GLN A . n A 1 30 LYS 30 26 26 LYS LYS A . n A 1 31 PHE 31 27 27 PHE PHE A . n A 1 32 LYS 32 28 28 LYS LYS A . n A 1 33 GLU 33 29 29 GLU GLU A . n A 1 34 ILE 34 30 30 ILE ILE A . n A 1 35 ARG 35 31 31 ARG ARG A . n A 1 36 GLU 36 32 32 GLU GLU A . n A 1 37 VAL 37 33 33 VAL VAL A . n A 1 38 LEU 38 34 34 LEU LEU A . n A 1 39 GLU 39 35 35 GLU GLU A . n A 1 40 GLY 40 36 36 GLY GLY A . n A 1 41 ASN 41 37 37 ASN ASN A . n A 1 42 ARG 42 38 38 ARG ARG A . n A 1 43 TYR 43 39 39 TYR TYR A . n A 1 44 TRP 44 40 40 TRP TRP A . n A 1 45 ALA 45 41 41 ALA ALA A . n A 1 46 ARG 46 42 42 ARG ARG A . n A 1 47 LYS 47 43 43 LYS LYS A . n A 1 48 VAL 48 44 44 VAL VAL A . n A 1 49 THR 49 45 45 THR THR A . n A 1 50 SER 50 46 46 SER SER A . n A 1 51 GLU 51 47 47 GLU GLU A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 PRO 53 49 49 PRO PRO A . n A 1 54 GLU 54 50 50 GLU GLU A . n A 1 55 PHE 55 51 51 PHE PHE A . n A 1 56 MET 56 52 52 MET MET A . n A 1 57 ALA 57 53 53 ALA ALA A . n A 1 58 GLU 58 54 54 GLU GLU A . n A 1 59 GLN 59 55 55 GLN GLN A . n A 1 60 VAL 60 56 56 VAL VAL A . n A 1 61 LYS 61 57 57 LYS LYS A . n A 1 62 GLY 62 58 58 GLY GLY A . n A 1 63 GLN 63 59 59 GLN GLN A . n A 1 64 ALA 64 60 60 ALA ALA A . n A 1 65 PRO 65 61 61 PRO PRO A . n A 1 66 ASN 66 62 62 ASN ASN A . n A 1 67 PHE 67 63 63 PHE PHE A . n A 1 68 LEU 68 64 64 LEU LEU A . n A 1 69 TRP 69 65 65 TRP TRP A . n A 1 70 ILE 70 66 66 ILE ILE A . n A 1 71 GLY 71 67 67 GLY GLY A . n A 1 72 CYS 72 68 68 CYS CYS A . n A 1 73 ALA 73 69 69 ALA ALA A . n A 1 74 ASP 74 70 70 ASP ASP A . n A 1 75 SER 75 71 71 SER SER A . n A 1 76 ARG 76 72 72 ARG ARG A . n A 1 77 VAL 77 73 73 VAL VAL A . n A 1 78 PRO 78 74 74 PRO PRO A . n A 1 79 GLU 79 75 75 GLU GLU A . n A 1 80 VAL 80 76 76 VAL VAL A . n A 1 81 THR 81 77 77 THR THR A . n A 1 82 ILE 82 78 78 ILE ILE A . n A 1 83 MET 83 79 79 MET MET A . n A 1 84 ALA 84 80 80 ALA ALA A . n A 1 85 ARG 85 81 81 ARG ARG A . n A 1 86 LYS 86 82 82 LYS LYS A . n A 1 87 PRO 87 83 83 PRO PRO A . n A 1 88 GLY 88 84 84 GLY GLY A . n A 1 89 ASP 89 85 85 ASP ASP A . n A 1 90 VAL 90 86 86 VAL VAL A . n A 1 91 PHE 91 87 87 PHE PHE A . n A 1 92 VAL 92 88 88 VAL VAL A . n A 1 93 GLN 93 89 89 GLN GLN A . n A 1 94 ARG 94 90 90 ARG ARG A . n A 1 95 ASN 95 91 91 ASN ASN A . n A 1 96 VAL 96 92 92 VAL VAL A . n A 1 97 ALA 97 93 93 ALA ALA A . n A 1 98 ASN 98 94 94 ASN ASN A . n A 1 99 GLN 99 95 95 GLN GLN A . n A 1 100 PHE 100 96 96 PHE PHE A . n A 1 101 LYS 101 97 97 LYS LYS A . n A 1 102 PRO 102 98 98 PRO PRO A . n A 1 103 GLU 103 99 99 GLU GLU A . n A 1 104 ASP 104 100 100 ASP ASP A . n A 1 105 ASP 105 101 101 ASP ASP A . n A 1 106 SER 106 102 102 SER SER A . n A 1 107 SER 107 103 103 SER SER A . n A 1 108 GLN 108 104 104 GLN GLN A . n A 1 109 ALA 109 105 105 ALA ALA A . n A 1 110 LEU 110 106 106 LEU LEU A . n A 1 111 LEU 111 107 107 LEU LEU A . n A 1 112 ASN 112 108 108 ASN ASN A . n A 1 113 TYR 113 109 109 TYR TYR A . n A 1 114 ALA 114 110 110 ALA ALA A . n A 1 115 ILE 115 111 111 ILE ILE A . n A 1 116 MET 116 112 112 MET MET A . n A 1 117 ASN 117 113 113 ASN ASN A . n A 1 118 VAL 118 114 114 VAL VAL A . n A 1 119 GLY 119 115 115 GLY GLY A . n A 1 120 VAL 120 116 116 VAL VAL A . n A 1 121 THR 121 117 117 THR THR A . n A 1 122 HIS 122 118 118 HIS HIS A . n A 1 123 VAL 123 119 119 VAL VAL A . n A 1 124 MET 124 120 120 MET MET A . n A 1 125 VAL 125 121 121 VAL VAL A . n A 1 126 VAL 126 122 122 VAL VAL A . n A 1 127 GLY 127 123 123 GLY GLY A . n A 1 128 HIS 128 124 124 HIS HIS A . n A 1 129 THR 129 125 125 THR THR A . n A 1 130 GLY 130 126 126 GLY GLY A . n A 1 131 CYS 131 127 127 CYS CYS A . n A 1 132 GLY 132 128 128 GLY GLY A . n A 1 133 GLY 133 129 129 GLY GLY A . n A 1 134 CYS 134 130 130 CYS CYS A . n A 1 135 ILE 135 131 131 ILE ILE A . n A 1 136 ALA 136 132 132 ALA ALA A . n A 1 137 ALA 137 133 133 ALA ALA A . n A 1 138 PHE 138 134 134 PHE PHE A . n A 1 139 ASP 139 135 135 ASP ASP A . n A 1 140 GLN 140 136 136 GLN GLN A . n A 1 141 PRO 141 137 137 PRO PRO A . n A 1 142 LEU 142 138 138 LEU LEU A . n A 1 143 PRO 143 139 139 PRO PRO A . n A 1 144 THR 144 140 ? ? ? A . n A 1 145 GLU 145 141 ? ? ? A . n A 1 146 GLU 146 142 ? ? ? A . n A 1 147 ASN 147 143 ? ? ? A . n A 1 148 PRO 148 144 ? ? ? A . n A 1 149 GLY 149 145 145 GLY GLY A . n A 1 150 GLY 150 146 146 GLY GLY A . n A 1 151 THR 151 147 147 THR THR A . n A 1 152 PRO 152 148 148 PRO PRO A . n A 1 153 LEU 153 149 149 LEU LEU A . n A 1 154 VAL 154 150 150 VAL VAL A . n A 1 155 ARG 155 151 151 ARG ARG A . n A 1 156 TYR 156 152 152 TYR TYR A . n A 1 157 LEU 157 153 153 LEU LEU A . n A 1 158 GLU 158 154 154 GLU GLU A . n A 1 159 PRO 159 155 155 PRO PRO A . n A 1 160 ILE 160 156 156 ILE ILE A . n A 1 161 ILE 161 157 157 ILE ILE A . n A 1 162 ARG 162 158 158 ARG ARG A . n A 1 163 LEU 163 159 159 LEU LEU A . n A 1 164 LYS 164 160 160 LYS LYS A . n A 1 165 HIS 165 161 161 HIS HIS A . n A 1 166 SER 166 162 162 SER SER A . n A 1 167 LEU 167 163 163 LEU LEU A . n A 1 168 PRO 168 164 164 PRO PRO A . n A 1 169 GLU 169 165 165 GLU GLU A . n A 1 170 GLY 170 166 166 GLY GLY A . n A 1 171 SER 171 167 167 SER SER A . n A 1 172 ASP 172 168 168 ASP ASP A . n A 1 173 VAL 173 169 169 VAL VAL A . n A 1 174 ASN 174 170 170 ASN ASN A . n A 1 175 ASP 175 171 171 ASP ASP A . n A 1 176 LEU 176 172 172 LEU LEU A . n A 1 177 ILE 177 173 173 ILE ILE A . n A 1 178 LYS 178 174 174 LYS LYS A . n A 1 179 GLU 179 175 175 GLU GLU A . n A 1 180 ASN 180 176 176 ASN ASN A . n A 1 181 VAL 181 177 177 VAL VAL A . n A 1 182 LYS 182 178 178 LYS LYS A . n A 1 183 MET 183 179 179 MET MET A . n A 1 184 ALA 184 180 180 ALA ALA A . n A 1 185 VAL 185 181 181 VAL VAL A . n A 1 186 LYS 186 182 182 LYS LYS A . n A 1 187 ASN 187 183 183 ASN ASN A . n A 1 188 VAL 188 184 184 VAL VAL A . n A 1 189 VAL 189 185 185 VAL VAL A . n A 1 190 ASN 190 186 186 ASN ASN A . n A 1 191 SER 191 187 187 SER SER A . n A 1 192 PRO 192 188 188 PRO PRO A . n A 1 193 THR 193 189 189 THR THR A . n A 1 194 ILE 194 190 190 ILE ILE A . n A 1 195 GLN 195 191 191 GLN GLN A . n A 1 196 GLY 196 192 192 GLY GLY A . n A 1 197 ALA 197 193 193 ALA ALA A . n A 1 198 TRP 198 194 194 TRP TRP A . n A 1 199 GLU 199 195 195 GLU GLU A . n A 1 200 GLN 200 196 196 GLN GLN A . n A 1 201 ALA 201 197 197 ALA ALA A . n A 1 202 ARG 202 198 198 ARG ARG A . n A 1 203 LYS 203 199 199 LYS LYS A . n A 1 204 GLY 204 200 200 GLY GLY A . n A 1 205 GLU 205 201 201 GLU GLU A . n A 1 206 PHE 206 202 202 PHE PHE A . n A 1 207 ARG 207 203 203 ARG ARG A . n A 1 208 GLU 208 204 204 GLU GLU A . n A 1 209 VAL 209 205 205 VAL VAL A . n A 1 210 PHE 210 206 206 PHE PHE A . n A 1 211 VAL 211 207 207 VAL VAL A . n A 1 212 HIS 212 208 208 HIS HIS A . n A 1 213 GLY 213 209 209 GLY GLY A . n A 1 214 TRP 214 210 210 TRP TRP A . n A 1 215 LEU 215 211 211 LEU LEU A . n A 1 216 TYR 216 212 212 TYR TYR A . n A 1 217 ASP 217 213 213 ASP ASP A . n A 1 218 LEU 218 214 214 LEU LEU A . n A 1 219 SER 219 215 215 SER SER A . n A 1 220 THR 220 216 216 THR THR A . n A 1 221 GLY 221 217 217 GLY GLY A . n A 1 222 ASN 222 218 218 ASN ASN A . n A 1 223 ILE 223 219 219 ILE ILE A . n A 1 224 VAL 224 220 220 VAL VAL A . n A 1 225 ASP 225 221 221 ASP ASP A . n A 1 226 LEU 226 222 222 LEU LEU A . n A 1 227 ASN 227 223 223 ASN ASN A . n A 1 228 VAL 228 224 224 VAL VAL A . n A 1 229 THR 229 225 225 THR THR A . n A 1 230 GLN 230 226 226 GLN GLN A . n A 1 231 GLY 231 227 227 GLY GLY A . n A 1 232 PRO 232 228 228 PRO PRO A . n A 1 233 HIS 233 229 229 HIS HIS A . n A 1 234 PRO 234 230 230 PRO PRO A . n A 1 235 PHE 235 231 ? ? ? A . n A 1 236 VAL 236 232 ? ? ? A . n A 1 237 ASP 237 233 ? ? ? A . n A 1 238 ASP 238 234 ? ? ? A . n A 1 239 ARG 239 235 ? ? ? A . n A 1 240 VAL 240 236 ? ? ? A . n A 1 241 PRO 241 237 ? ? ? A . n A 1 242 ARG 242 238 ? ? ? A . n A 1 243 ALA 243 239 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1231 1231 ZN ZN A . C 3 CL 1 1232 1232 CL CL A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . D 4 HOH 129 2129 2129 HOH HOH A . D 4 HOH 130 2130 2130 HOH HOH A . D 4 HOH 131 2131 2131 HOH HOH A . D 4 HOH 132 2132 2132 HOH HOH A . D 4 HOH 133 2133 2133 HOH HOH A . D 4 HOH 134 2134 2134 HOH HOH A . D 4 HOH 135 2135 2135 HOH HOH A . D 4 HOH 136 2136 2136 HOH HOH A . D 4 HOH 137 2137 2137 HOH HOH A . D 4 HOH 138 2138 2138 HOH HOH A . D 4 HOH 139 2139 2139 HOH HOH A . D 4 HOH 140 2140 2140 HOH HOH A . D 4 HOH 141 2141 2141 HOH HOH A . D 4 HOH 142 2142 2142 HOH HOH A . D 4 HOH 143 2143 2143 HOH HOH A . D 4 HOH 144 2144 2144 HOH HOH A . D 4 HOH 145 2145 2145 HOH HOH A . D 4 HOH 146 2146 2146 HOH HOH A . D 4 HOH 147 2147 2147 HOH HOH A . D 4 HOH 148 2148 2148 HOH HOH A . D 4 HOH 149 2149 2149 HOH HOH A . D 4 HOH 150 2150 2150 HOH HOH A . D 4 HOH 151 2151 2151 HOH HOH A . D 4 HOH 152 2152 2152 HOH HOH A . D 4 HOH 153 2153 2153 HOH HOH A . D 4 HOH 154 2154 2154 HOH HOH A . D 4 HOH 155 2155 2155 HOH HOH A . D 4 HOH 156 2156 2156 HOH HOH A . D 4 HOH 157 2157 2157 HOH HOH A . D 4 HOH 158 2158 2158 HOH HOH A . D 4 HOH 159 2159 2159 HOH HOH A . D 4 HOH 160 2160 2160 HOH HOH A . D 4 HOH 161 2161 2161 HOH HOH A . D 4 HOH 162 2162 2162 HOH HOH A . D 4 HOH 163 2163 2163 HOH HOH A . D 4 HOH 164 2164 2164 HOH HOH A . D 4 HOH 165 2165 2165 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 7140 ? 1 MORE -48.3 ? 1 'SSA (A^2)' 24530 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 44.8633333333 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2063 ? D HOH . 2 1 A HOH 2064 ? D HOH . 3 1 A HOH 2068 ? D HOH . 4 1 A HOH 2081 ? D HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 131 ? A CYS 127 ? 1_555 ZN ? B ZN . ? A ZN 1231 ? 1_555 SG ? A CYS 72 ? A CYS 68 ? 1_555 121.0 ? 2 SG ? A CYS 131 ? A CYS 127 ? 1_555 ZN ? B ZN . ? A ZN 1231 ? 1_555 NE2 ? A HIS 128 ? A HIS 124 ? 1_555 109.9 ? 3 SG ? A CYS 72 ? A CYS 68 ? 1_555 ZN ? B ZN . ? A ZN 1231 ? 1_555 NE2 ? A HIS 128 ? A HIS 124 ? 1_555 112.5 ? 4 SG ? A CYS 131 ? A CYS 127 ? 1_555 ZN ? B ZN . ? A ZN 1231 ? 1_555 O ? D HOH . ? A HOH 2165 ? 1_555 108.1 ? 5 SG ? A CYS 72 ? A CYS 68 ? 1_555 ZN ? B ZN . ? A ZN 1231 ? 1_555 O ? D HOH . ? A HOH 2165 ? 1_555 108.0 ? 6 NE2 ? A HIS 128 ? A HIS 124 ? 1_555 ZN ? B ZN . ? A ZN 1231 ? 1_555 O ? D HOH . ? A HOH 2165 ? 1_555 93.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-12-30 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELXL-97 refinement . ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 PHASER phasing . ? 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH1 A ARG 31 ? ? 123.71 120.30 3.41 0.50 N 2 1 NE A ARG 31 ? ? CZ A ARG 31 ? ? NH2 A ARG 31 ? ? 116.96 120.30 -3.34 0.50 N 3 1 CD A ARG 38 ? ? NE A ARG 38 ? ? CZ A ARG 38 ? ? 134.94 123.60 11.34 1.40 N 4 1 NE A ARG 38 ? ? CZ A ARG 38 ? ? NH1 A ARG 38 ? ? 125.41 120.30 5.11 0.50 N 5 1 NE A ARG 81 ? ? CZ A ARG 81 ? ? NH1 A ARG 81 ? ? 114.62 120.30 -5.68 0.50 N 6 1 NE A ARG 90 ? ? CZ A ARG 90 ? ? NH1 A ARG 90 ? ? 115.63 120.30 -4.67 0.50 N 7 1 CB A ASP 100 ? ? CG A ASP 100 ? ? OD1 A ASP 100 ? ? 111.39 118.30 -6.91 0.90 N 8 1 CB A TYR 109 ? ? CG A TYR 109 ? ? CD1 A TYR 109 ? ? 125.35 121.00 4.35 0.60 N 9 1 NE A ARG 151 ? ? CZ A ARG 151 ? ? NH1 A ARG 151 ? ? 123.59 120.30 3.29 0.50 N 10 1 NE A ARG 198 ? ? CZ A ARG 198 ? ? NH2 A ARG 198 ? ? 116.89 120.30 -3.41 0.50 N 11 1 NE A ARG 203 ? ? CZ A ARG 203 ? ? NH2 A ARG 203 ? ? 117.16 120.30 -3.14 0.50 N 12 1 C A ASN 218 ? ? N A ILE 219 ? ? CA A ILE 219 ? ? 137.85 121.70 16.15 2.50 Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ALA _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 60 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -144.75 _pdbx_validate_torsion.psi 58.10 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 16 ? CE ? A MET 20 CE 2 1 Y 1 A LYS 26 ? CE ? A LYS 30 CE 3 1 Y 1 A LYS 26 ? NZ ? A LYS 30 NZ 4 1 Y 1 A MET 120 ? CE ? A MET 124 CE 5 1 Y 1 A GLU 165 ? CG ? A GLU 169 CG 6 1 Y 1 A GLU 165 ? CD ? A GLU 169 CD 7 1 Y 1 A GLU 165 ? OE1 ? A GLU 169 OE1 8 1 Y 1 A GLU 165 ? OE2 ? A GLU 169 OE2 9 1 Y 1 A LYS 182 ? CD ? A LYS 186 CD 10 1 Y 1 A LYS 182 ? CE ? A LYS 186 CE 11 1 Y 1 A LYS 182 ? NZ ? A LYS 186 NZ 12 1 Y 1 A GLU 195 ? CG ? A GLU 199 CG 13 1 Y 1 A GLU 195 ? CD ? A GLU 199 CD 14 1 Y 1 A GLU 195 ? OE1 ? A GLU 199 OE1 15 1 Y 1 A GLU 195 ? OE2 ? A GLU 199 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 140 ? A THR 144 2 1 Y 1 A GLU 141 ? A GLU 145 3 1 Y 1 A GLU 142 ? A GLU 146 4 1 Y 1 A ASN 143 ? A ASN 147 5 1 Y 1 A PRO 144 ? A PRO 148 6 1 Y 1 A PHE 231 ? A PHE 235 7 1 Y 1 A VAL 232 ? A VAL 236 8 1 Y 1 A ASP 233 ? A ASP 237 9 1 Y 1 A ASP 234 ? A ASP 238 10 1 Y 1 A ARG 235 ? A ARG 239 11 1 Y 1 A VAL 236 ? A VAL 240 12 1 Y 1 A PRO 237 ? A PRO 241 13 1 Y 1 A ARG 238 ? A ARG 242 14 1 Y 1 A ALA 239 ? A ALA 243 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CHLORIDE ION' CL 4 water HOH #