data_2WA8 # _entry.id 2WA8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2WA8 PDBE EBI-38699 WWPDB D_1290038699 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1MBU unspecified 'CRYSTAL STRUCTURE ANALYSIS OF CLPSN HETERODIMER' PDB 1LZW unspecified 'STRUCTURAL BASIS OF CLPS-MEDIATED SWITCH IN CLPA SUBSTRATERECOGNITION' PDB 2W9R unspecified 'STRUCTURAL BASIS OF N-END RULE SUBSTRATE RECOGNITION IN ESCHERICHIA COLI BY THE CLPAP ADAPTOR PROTEIN CLPS' PDB 1MG9 unspecified 'THE STRUCTURAL BASIS OF CLPS-MEDIATED SWITCH IN CLPASUBSTRATE RECOGNITION' PDB 1MBV unspecified 'CRYSTAL STRUCTURE ANALYSIS OF CLPSN HETERODIMER TETRAGONALFORM' PDB 1R6O unspecified 'ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT CLPA/ATP-DEPENDENT CLP PROTEASE ADAPTOR PROTEIN CLPS' PDB 1R6Q unspecified 'CLPNS WITH FRAGMENTS' PDB 1MBX unspecified 'CRYSTAL STRUCTURE ANALYSIS OF CLPSN WITH TRANSITION METALION BOUND' PDB 2WA9 unspecified 'STRUCTURAL BASIS OF N-END RULE SUBSTRATE RECOGNITION IN ESCHERICHIA COLI BY THE CLPAP ADAPTOR PROTEIN CLPS - TRP PEPTIDE STRUCTURE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2WA8 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-02-03 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schuenemann, V.J.' 1 'Kralik, S.M.' 2 'Albrecht, R.' 3 'Spall, S.K.' 4 'Truscott, K.N.' 5 'Dougan, D.A.' 6 'Zeth, K.' 7 # _citation.id primary _citation.title 'Structural Basis of N-End Rule Substrate Recognition in Escherichia Coli by the Clpap Adaptor Protein Clps.' _citation.journal_abbrev 'Embo Rep.' _citation.journal_volume 10 _citation.page_first 508 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1469-221X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19373253 _citation.pdbx_database_id_DOI 10.1038/EMBOR.2009.62 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Schuenemann, V.J.' 1 primary 'Kralik, S.M.' 2 primary 'Albrecht, R.' 3 primary 'Spall, S.K.' 4 primary 'Truscott, K.N.' 5 primary 'Dougan, D.A.' 6 primary 'Zeth, K.' 7 # _cell.entry_id 2WA8 _cell.length_a 32.223 _cell.length_b 58.405 _cell.length_c 56.413 _cell.angle_alpha 90.00 _cell.angle_beta 101.89 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2WA8 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS' 12340.212 2 ? ? ? 'CLPS PROTEIN FROM E. COLI AND N-END RULE PEPTIDE' 2 polymer syn 'N-END RULE PEPTIDE' 1215.355 2 ? ? ? ? 3 water nat water 18.015 91 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CLPS - PHE-PEPTIDE COMPLEX' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEV AETKVAMVNKYARENEHPLLCTLEKAF ; ;MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEV AETKVAMVNKYARENEHPLLCTLEKAF ; A,C ? 2 'polypeptide(L)' no no FRSKGEELFT FRSKGEELFT B,D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 THR n 1 5 ASN n 1 6 ASP n 1 7 TRP n 1 8 LEU n 1 9 ASP n 1 10 PHE n 1 11 ASP n 1 12 GLN n 1 13 LEU n 1 14 ALA n 1 15 GLU n 1 16 GLU n 1 17 LYS n 1 18 VAL n 1 19 ARG n 1 20 ASP n 1 21 ALA n 1 22 LEU n 1 23 LYS n 1 24 PRO n 1 25 PRO n 1 26 SER n 1 27 MET n 1 28 TYR n 1 29 LYS n 1 30 VAL n 1 31 ILE n 1 32 LEU n 1 33 VAL n 1 34 ASN n 1 35 ASP n 1 36 ASP n 1 37 TYR n 1 38 THR n 1 39 PRO n 1 40 MET n 1 41 GLU n 1 42 PHE n 1 43 VAL n 1 44 ILE n 1 45 ASP n 1 46 VAL n 1 47 LEU n 1 48 GLN n 1 49 LYS n 1 50 PHE n 1 51 PHE n 1 52 SER n 1 53 TYR n 1 54 ASP n 1 55 VAL n 1 56 GLU n 1 57 ARG n 1 58 ALA n 1 59 THR n 1 60 GLN n 1 61 LEU n 1 62 MET n 1 63 LEU n 1 64 ALA n 1 65 VAL n 1 66 HIS n 1 67 TYR n 1 68 GLN n 1 69 GLY n 1 70 LYS n 1 71 ALA n 1 72 ILE n 1 73 CYS n 1 74 GLY n 1 75 VAL n 1 76 PHE n 1 77 THR n 1 78 ALA n 1 79 GLU n 1 80 VAL n 1 81 ALA n 1 82 GLU n 1 83 THR n 1 84 LYS n 1 85 VAL n 1 86 ALA n 1 87 MET n 1 88 VAL n 1 89 ASN n 1 90 LYS n 1 91 TYR n 1 92 ALA n 1 93 ARG n 1 94 GLU n 1 95 ASN n 1 96 GLU n 1 97 HIS n 1 98 PRO n 1 99 LEU n 1 100 LEU n 1 101 CYS n 1 102 THR n 1 103 LEU n 1 104 GLU n 1 105 LYS n 1 106 ALA n 1 107 PHE n 2 1 PHE n 2 2 ARG n 2 3 SER n 2 4 LYS n 2 5 GLY n 2 6 GLU n 2 7 GLU n 2 8 LEU n 2 9 PHE n 2 10 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(GOLD)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'ESCHERICHIA COLI' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 562 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP CLPS_ECOLI 1 ? ? P0A8Q6 ? 2 PDB 2WA8 1 ? ? 2WA8 ? 3 PDB 2WA8 2 ? ? 2WA8 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2WA8 A 1 ? 106 ? P0A8Q6 1 ? 106 ? 1 106 2 2 2WA8 A 107 ? 107 ? 2WA8 107 ? 107 ? 107 107 3 3 2WA8 B 1 ? 10 ? 2WA8 1 ? 10 ? 1 10 4 1 2WA8 C 1 ? 106 ? P0A8Q6 1 ? 106 ? 1 106 5 2 2WA8 C 107 ? 107 ? 2WA8 107 ? 107 ? 107 107 6 3 2WA8 D 1 ? 10 ? 2WA8 107 ? 116 ? 107 116 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2WA8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.1 _exptl_crystal.density_percent_sol 45 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 8.5' # _diffrn.id 1 _diffrn.ambient_temp 90 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_wavelength 1 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2WA8 _reflns.observed_criterion_sigma_I 2.3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.00 _reflns.d_resolution_high 2.15 _reflns.number_obs 10728 _reflns.number_all ? _reflns.percent_possible_obs 94.0 _reflns.pdbx_Rmerge_I_obs 0.01 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 6.60 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.8 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.15 _reflns_shell.d_res_low 2.27 _reflns_shell.percent_possible_all 90.5 _reflns_shell.Rmerge_I_obs 0.45 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.30 _reflns_shell.pdbx_redundancy 2.7 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2WA8 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 9909 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 2.15 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.228 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.225 _refine.ls_R_factor_R_free 0.268 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 7.000 _refine.ls_number_reflns_R_free 747 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.938 _refine.correlation_coeff_Fo_to_Fc_free 0.910 _refine.B_iso_mean 33.16 _refine.aniso_B[1][1] -1.13000 _refine.aniso_B[2][2] 2.02000 _refine.aniso_B[3][3] -0.82000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.16000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.385 _refine.pdbx_overall_ESU_R_Free 0.248 _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1660 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1751 _refine_hist.d_res_high 2.15 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.010 0.022 ? 1692 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.542 1.967 ? 2284 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.932 5.000 ? 203 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 39.623 24.810 ? 79 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.120 15.000 ? 303 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.084 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.119 0.200 ? 258 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 1257 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.288 0.200 ? 844 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.334 0.200 ? 1189 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.152 0.200 ? 82 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.316 0.200 ? 158 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.181 0.200 ? 7 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 4.920 1.500 ? 1033 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 6.323 2.000 ? 1666 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 7.258 3.000 ? 659 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 10.417 4.500 ? 618 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso 1 A 244 0.02 0.50 'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 2 C 244 0.02 0.50 'medium positional' 1 2 'X-RAY DIFFRACTION' ? ? ? 1 A 239 0.03 5.00 'loose positional' 1 3 'X-RAY DIFFRACTION' ? ? ? 2 C 239 0.03 5.00 'loose positional' 1 4 'X-RAY DIFFRACTION' ? ? ? 1 A 244 0.95 2.00 'medium thermal' 1 5 'X-RAY DIFFRACTION' ? ? ? 2 C 244 0.95 2.00 'medium thermal' 1 6 'X-RAY DIFFRACTION' ? ? ? 1 A 239 1.11 10.00 'loose thermal' 1 7 'X-RAY DIFFRACTION' ? ? ? 2 C 239 1.11 10.00 'loose thermal' 1 8 'X-RAY DIFFRACTION' ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.15 _refine_ls_shell.d_res_low 2.21 _refine_ls_shell.number_reflns_R_work 716 _refine_ls_shell.R_factor_R_work 0.2600 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.3350 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 54 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _struct_ncs_dom.id _struct_ncs_dom.details _struct_ncs_dom.pdbx_ens_id 1 A 1 2 C 1 # loop_ _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.selection_details 1 A 30 A 90 1 5 ? ? ? ? ? ? ? ? 1 ? 2 C 30 C 90 1 5 ? ? ? ? ? ? ? ? 1 ? # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 2WA8 _struct.title ;Structural basis of N-end rule substrate recognition in Escherichia coli by the ClpAP adaptor protein ClpS - The Phe peptide structure ; _struct.pdbx_descriptor 'ATP-DEPENDENT CLP PROTEASE ADAPTER PROTEIN CLPS, N-END RULE PEPTIDE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2WA8 _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' _struct_keywords.text 'N-END RULE, PHE PEPTIDE, CLPS, CLPA, CLPP, PEPTIDE-BINDING PROTEIN, PEPTIDE BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 39 ? SER A 52 ? PRO A 39 SER A 52 1 ? 14 HELX_P HELX_P2 2 ASP A 54 ? GLY A 69 ? ASP A 54 GLY A 69 1 ? 16 HELX_P HELX_P3 3 ALA A 78 ? ASN A 95 ? ALA A 78 ASN A 95 1 ? 18 HELX_P HELX_P4 4 GLU C 16 ? LEU C 22 ? GLU C 16 LEU C 22 1 ? 7 HELX_P HELX_P5 5 PRO C 39 ? SER C 52 ? PRO C 39 SER C 52 1 ? 14 HELX_P HELX_P6 6 ASP C 54 ? GLY C 69 ? ASP C 54 GLY C 69 1 ? 16 HELX_P HELX_P7 7 ALA C 78 ? ASN C 95 ? ALA C 78 ASN C 95 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 6 B . ? GLU 6 B GLU 7 B ? GLU 7 B 1 10.02 2 GLU 7 B . ? GLU 7 B LEU 8 B ? LEU 8 B 1 -0.20 3 TRP 7 C . ? TRP 7 C LEU 8 C ? LEU 8 C 1 6.44 4 GLN 12 C . ? GLN 12 C LEU 13 C ? LEU 13 C 1 -7.99 5 ALA 14 C . ? ALA 14 C GLU 15 C ? GLU 15 C 1 -12.26 6 GLU 15 C . ? GLU 15 C GLU 16 C ? GLU 16 C 1 21.95 7 LYS 4 D . ? LYS 110 D GLY 5 D ? GLY 111 D 1 5.85 8 GLY 5 D . ? GLY 111 D GLU 6 D ? GLU 112 D 1 -5.16 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 3 ? CA ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel CA 1 2 ? anti-parallel CA 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LYS A 70 ? THR A 77 ? LYS A 70 THR A 77 AA 2 MET A 27 ? VAL A 33 ? MET A 27 VAL A 33 AA 3 LEU A 100 ? LYS A 105 ? LEU A 100 LYS A 105 CA 1 LYS C 70 ? THR C 77 ? LYS C 70 THR C 77 CA 2 MET C 27 ? VAL C 33 ? MET C 27 VAL C 33 CA 3 LEU C 100 ? LYS C 105 ? LEU C 100 LYS C 105 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N PHE A 76 ? N PHE A 76 O TYR A 28 ? O TYR A 28 AA 2 3 N VAL A 33 ? N VAL A 33 O LEU A 100 ? O LEU A 100 CA 1 2 N PHE C 76 ? N PHE C 76 O TYR C 28 ? O TYR C 28 CA 2 3 N VAL C 33 ? N VAL C 33 O LEU C 100 ? O LEU C 100 # _database_PDB_matrix.entry_id 2WA8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2WA8 _atom_sites.fract_transf_matrix[1][1] 0.031034 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.006534 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017122 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018115 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 TRP 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 ASP 9 9 ? ? ? A . n A 1 10 PHE 10 10 ? ? ? A . n A 1 11 ASP 11 11 ? ? ? A . n A 1 12 GLN 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 GLU 15 15 ? ? ? A . n A 1 16 GLU 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 MET 87 87 87 MET MET A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 PRO 98 98 98 PRO PRO A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 ? ? ? A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 SER 3 3 3 SER SER B . n B 2 4 LYS 4 4 4 LYS LYS B . n B 2 5 GLY 5 5 5 GLY GLY B . n B 2 6 GLU 6 6 6 GLU GLU B . n B 2 7 GLU 7 7 7 GLU GLU B . n B 2 8 LEU 8 8 8 LEU LEU B . n B 2 9 PHE 9 9 9 PHE PHE B . n B 2 10 THR 10 10 10 THR THR B . n C 1 1 MET 1 1 ? ? ? C . n C 1 2 GLY 2 2 ? ? ? C . n C 1 3 LYS 3 3 ? ? ? C . n C 1 4 THR 4 4 4 THR THR C . n C 1 5 ASN 5 5 5 ASN ASN C . n C 1 6 ASP 6 6 6 ASP ASP C . n C 1 7 TRP 7 7 7 TRP TRP C . n C 1 8 LEU 8 8 8 LEU LEU C . n C 1 9 ASP 9 9 9 ASP ASP C . n C 1 10 PHE 10 10 10 PHE PHE C . n C 1 11 ASP 11 11 11 ASP ASP C . n C 1 12 GLN 12 12 12 GLN GLN C . n C 1 13 LEU 13 13 13 LEU LEU C . n C 1 14 ALA 14 14 14 ALA ALA C . n C 1 15 GLU 15 15 15 GLU GLU C . n C 1 16 GLU 16 16 16 GLU GLU C . n C 1 17 LYS 17 17 17 LYS LYS C . n C 1 18 VAL 18 18 18 VAL VAL C . n C 1 19 ARG 19 19 19 ARG ARG C . n C 1 20 ASP 20 20 20 ASP ASP C . n C 1 21 ALA 21 21 21 ALA ALA C . n C 1 22 LEU 22 22 22 LEU LEU C . n C 1 23 LYS 23 23 23 LYS LYS C . n C 1 24 PRO 24 24 24 PRO PRO C . n C 1 25 PRO 25 25 25 PRO PRO C . n C 1 26 SER 26 26 26 SER SER C . n C 1 27 MET 27 27 27 MET MET C . n C 1 28 TYR 28 28 28 TYR TYR C . n C 1 29 LYS 29 29 29 LYS LYS C . n C 1 30 VAL 30 30 30 VAL VAL C . n C 1 31 ILE 31 31 31 ILE ILE C . n C 1 32 LEU 32 32 32 LEU LEU C . n C 1 33 VAL 33 33 33 VAL VAL C . n C 1 34 ASN 34 34 34 ASN ASN C . n C 1 35 ASP 35 35 35 ASP ASP C . n C 1 36 ASP 36 36 36 ASP ASP C . n C 1 37 TYR 37 37 37 TYR TYR C . n C 1 38 THR 38 38 38 THR THR C . n C 1 39 PRO 39 39 39 PRO PRO C . n C 1 40 MET 40 40 40 MET MET C . n C 1 41 GLU 41 41 41 GLU GLU C . n C 1 42 PHE 42 42 42 PHE PHE C . n C 1 43 VAL 43 43 43 VAL VAL C . n C 1 44 ILE 44 44 44 ILE ILE C . n C 1 45 ASP 45 45 45 ASP ASP C . n C 1 46 VAL 46 46 46 VAL VAL C . n C 1 47 LEU 47 47 47 LEU LEU C . n C 1 48 GLN 48 48 48 GLN GLN C . n C 1 49 LYS 49 49 49 LYS LYS C . n C 1 50 PHE 50 50 50 PHE PHE C . n C 1 51 PHE 51 51 51 PHE PHE C . n C 1 52 SER 52 52 52 SER SER C . n C 1 53 TYR 53 53 53 TYR TYR C . n C 1 54 ASP 54 54 54 ASP ASP C . n C 1 55 VAL 55 55 55 VAL VAL C . n C 1 56 GLU 56 56 56 GLU GLU C . n C 1 57 ARG 57 57 57 ARG ARG C . n C 1 58 ALA 58 58 58 ALA ALA C . n C 1 59 THR 59 59 59 THR THR C . n C 1 60 GLN 60 60 60 GLN GLN C . n C 1 61 LEU 61 61 61 LEU LEU C . n C 1 62 MET 62 62 62 MET MET C . n C 1 63 LEU 63 63 63 LEU LEU C . n C 1 64 ALA 64 64 64 ALA ALA C . n C 1 65 VAL 65 65 65 VAL VAL C . n C 1 66 HIS 66 66 66 HIS HIS C . n C 1 67 TYR 67 67 67 TYR TYR C . n C 1 68 GLN 68 68 68 GLN GLN C . n C 1 69 GLY 69 69 69 GLY GLY C . n C 1 70 LYS 70 70 70 LYS LYS C . n C 1 71 ALA 71 71 71 ALA ALA C . n C 1 72 ILE 72 72 72 ILE ILE C . n C 1 73 CYS 73 73 73 CYS CYS C . n C 1 74 GLY 74 74 74 GLY GLY C . n C 1 75 VAL 75 75 75 VAL VAL C . n C 1 76 PHE 76 76 76 PHE PHE C . n C 1 77 THR 77 77 77 THR THR C . n C 1 78 ALA 78 78 78 ALA ALA C . n C 1 79 GLU 79 79 79 GLU GLU C . n C 1 80 VAL 80 80 80 VAL VAL C . n C 1 81 ALA 81 81 81 ALA ALA C . n C 1 82 GLU 82 82 82 GLU GLU C . n C 1 83 THR 83 83 83 THR THR C . n C 1 84 LYS 84 84 84 LYS LYS C . n C 1 85 VAL 85 85 85 VAL VAL C . n C 1 86 ALA 86 86 86 ALA ALA C . n C 1 87 MET 87 87 87 MET MET C . n C 1 88 VAL 88 88 88 VAL VAL C . n C 1 89 ASN 89 89 89 ASN ASN C . n C 1 90 LYS 90 90 90 LYS LYS C . n C 1 91 TYR 91 91 91 TYR TYR C . n C 1 92 ALA 92 92 92 ALA ALA C . n C 1 93 ARG 93 93 93 ARG ARG C . n C 1 94 GLU 94 94 94 GLU GLU C . n C 1 95 ASN 95 95 95 ASN ASN C . n C 1 96 GLU 96 96 96 GLU GLU C . n C 1 97 HIS 97 97 97 HIS HIS C . n C 1 98 PRO 98 98 98 PRO PRO C . n C 1 99 LEU 99 99 99 LEU LEU C . n C 1 100 LEU 100 100 100 LEU LEU C . n C 1 101 CYS 101 101 101 CYS CYS C . n C 1 102 THR 102 102 102 THR THR C . n C 1 103 LEU 103 103 103 LEU LEU C . n C 1 104 GLU 104 104 104 GLU GLU C . n C 1 105 LYS 105 105 105 LYS LYS C . n C 1 106 ALA 106 106 106 ALA ALA C . n C 1 107 PHE 107 107 ? ? ? C . n D 2 1 PHE 1 107 107 PHE PHE D . n D 2 2 ARG 2 108 108 ARG ARG D . n D 2 3 SER 3 109 109 SER SER D . n D 2 4 LYS 4 110 110 LYS LYS D . n D 2 5 GLY 5 111 111 GLY GLY D . n D 2 6 GLU 6 112 112 GLU GLU D . n D 2 7 GLU 7 113 ? ? ? D . n D 2 8 LEU 8 114 ? ? ? D . n D 2 9 PHE 9 115 ? ? ? D . n D 2 10 THR 10 116 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 2001 2001 HOH HOH A . E 3 HOH 2 2002 2002 HOH HOH A . E 3 HOH 3 2003 2003 HOH HOH A . E 3 HOH 4 2004 2004 HOH HOH A . E 3 HOH 5 2005 2005 HOH HOH A . E 3 HOH 6 2006 2006 HOH HOH A . E 3 HOH 7 2007 2007 HOH HOH A . E 3 HOH 8 2008 2008 HOH HOH A . E 3 HOH 9 2009 2009 HOH HOH A . E 3 HOH 10 2010 2010 HOH HOH A . E 3 HOH 11 2011 2011 HOH HOH A . E 3 HOH 12 2012 2012 HOH HOH A . E 3 HOH 13 2013 2013 HOH HOH A . E 3 HOH 14 2014 2014 HOH HOH A . E 3 HOH 15 2015 2015 HOH HOH A . E 3 HOH 16 2016 2016 HOH HOH A . E 3 HOH 17 2017 2017 HOH HOH A . E 3 HOH 18 2018 2018 HOH HOH A . E 3 HOH 19 2019 2019 HOH HOH A . E 3 HOH 20 2020 2020 HOH HOH A . E 3 HOH 21 2021 2021 HOH HOH A . E 3 HOH 22 2022 2022 HOH HOH A . E 3 HOH 23 2023 2023 HOH HOH A . E 3 HOH 24 2024 2024 HOH HOH A . E 3 HOH 25 2025 2025 HOH HOH A . E 3 HOH 26 2026 2026 HOH HOH A . E 3 HOH 27 2027 2027 HOH HOH A . E 3 HOH 28 2028 2028 HOH HOH A . E 3 HOH 29 2029 2029 HOH HOH A . E 3 HOH 30 2030 2030 HOH HOH A . E 3 HOH 31 2031 2031 HOH HOH A . E 3 HOH 32 2032 2032 HOH HOH A . E 3 HOH 33 2033 2033 HOH HOH A . E 3 HOH 34 2034 2034 HOH HOH A . E 3 HOH 35 2035 2035 HOH HOH A . E 3 HOH 36 2036 2036 HOH HOH A . E 3 HOH 37 2037 2037 HOH HOH A . E 3 HOH 38 2038 2038 HOH HOH A . E 3 HOH 39 2039 2039 HOH HOH A . E 3 HOH 40 2040 2040 HOH HOH A . E 3 HOH 41 2041 2041 HOH HOH A . E 3 HOH 42 2042 2042 HOH HOH A . F 3 HOH 1 2001 2001 HOH HOH B . F 3 HOH 2 2002 2002 HOH HOH B . F 3 HOH 3 2003 2003 HOH HOH B . F 3 HOH 4 2004 2004 HOH HOH B . F 3 HOH 5 2005 2005 HOH HOH B . F 3 HOH 6 2006 2006 HOH HOH B . G 3 HOH 1 2001 2001 HOH HOH C . G 3 HOH 2 2002 2002 HOH HOH C . G 3 HOH 3 2003 2003 HOH HOH C . G 3 HOH 4 2004 2004 HOH HOH C . G 3 HOH 5 2005 2005 HOH HOH C . G 3 HOH 6 2006 2006 HOH HOH C . G 3 HOH 7 2007 2007 HOH HOH C . G 3 HOH 8 2008 2008 HOH HOH C . G 3 HOH 9 2009 2009 HOH HOH C . G 3 HOH 10 2010 2010 HOH HOH C . G 3 HOH 11 2011 2011 HOH HOH C . G 3 HOH 12 2012 2012 HOH HOH C . G 3 HOH 13 2013 2013 HOH HOH C . G 3 HOH 14 2014 2014 HOH HOH C . G 3 HOH 15 2015 2015 HOH HOH C . G 3 HOH 16 2016 2016 HOH HOH C . G 3 HOH 17 2017 2017 HOH HOH C . G 3 HOH 18 2018 2018 HOH HOH C . G 3 HOH 19 2019 2019 HOH HOH C . G 3 HOH 20 2020 2020 HOH HOH C . G 3 HOH 21 2021 2021 HOH HOH C . G 3 HOH 22 2022 2022 HOH HOH C . G 3 HOH 23 2023 2023 HOH HOH C . G 3 HOH 24 2024 2024 HOH HOH C . G 3 HOH 25 2025 2025 HOH HOH C . G 3 HOH 26 2026 2026 HOH HOH C . G 3 HOH 27 2027 2027 HOH HOH C . G 3 HOH 28 2028 2028 HOH HOH C . G 3 HOH 29 2029 2029 HOH HOH C . G 3 HOH 30 2030 2030 HOH HOH C . G 3 HOH 31 2031 2031 HOH HOH C . G 3 HOH 32 2032 2032 HOH HOH C . G 3 HOH 33 2033 2033 HOH HOH C . G 3 HOH 34 2034 2034 HOH HOH C . G 3 HOH 35 2035 2035 HOH HOH C . G 3 HOH 36 2036 2036 HOH HOH C . G 3 HOH 37 2037 2037 HOH HOH C . G 3 HOH 38 2038 2038 HOH HOH C . G 3 HOH 39 2039 2039 HOH HOH C . G 3 HOH 40 2040 2040 HOH HOH C . G 3 HOH 41 2041 2041 HOH HOH C . H 3 HOH 1 2001 2001 HOH HOH D . H 3 HOH 2 2002 2002 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 software_defined_assembly PQS dimeric 2 2 software_defined_assembly PQS dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F 2 1 C,D,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1200 ? 1 MORE -12.5 ? 1 'SSA (A^2)' 7360 ? 2 'ABSA (A^2)' 800 ? 2 MORE -6.5 ? 2 'SSA (A^2)' 9390 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-04-28 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 XDS 'data reduction' . ? 2 XDS 'data scaling' . ? 3 MOLREP phasing . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 20 ? ? 78.09 -143.34 2 1 ALA A 21 ? ? -133.33 -141.44 3 1 LEU A 22 ? ? -150.21 -156.76 4 1 LYS A 23 ? ? 71.22 -169.45 5 1 GLU B 7 ? ? 165.38 129.33 6 1 LEU C 8 ? ? 91.48 158.43 7 1 ASP C 9 ? ? 65.87 70.81 8 1 LEU C 13 ? ? 178.88 61.99 9 1 GLU C 15 ? ? 136.01 -6.50 10 1 GLU C 16 ? ? 72.71 -63.87 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id C _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2006 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 8.81 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C THR 4 ? OG1 ? C THR 4 OG1 2 1 Y 1 C THR 4 ? CG2 ? C THR 4 CG2 3 1 Y 1 C ASP 9 ? CG ? C ASP 9 CG 4 1 Y 1 C ASP 9 ? OD1 ? C ASP 9 OD1 5 1 Y 1 C ASP 9 ? OD2 ? C ASP 9 OD2 6 1 Y 1 C ARG 19 ? CG ? C ARG 19 CG 7 1 Y 1 C ARG 19 ? CD ? C ARG 19 CD 8 1 Y 1 C ARG 19 ? NE ? C ARG 19 NE 9 1 Y 1 C ARG 19 ? CZ ? C ARG 19 CZ 10 1 Y 1 C ARG 19 ? NH1 ? C ARG 19 NH1 11 1 Y 1 C ARG 19 ? NH2 ? C ARG 19 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A TRP 7 ? A TRP 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A ASP 9 ? A ASP 9 10 1 Y 1 A PHE 10 ? A PHE 10 11 1 Y 1 A ASP 11 ? A ASP 11 12 1 Y 1 A GLN 12 ? A GLN 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A GLU 15 ? A GLU 15 16 1 Y 1 A GLU 16 ? A GLU 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A PHE 107 ? A PHE 107 20 1 Y 1 C MET 1 ? C MET 1 21 1 Y 1 C GLY 2 ? C GLY 2 22 1 Y 1 C LYS 3 ? C LYS 3 23 1 Y 1 C PHE 107 ? C PHE 107 24 1 Y 1 D GLU 113 ? D GLU 7 25 1 Y 1 D LEU 114 ? D LEU 8 26 1 Y 1 D PHE 115 ? D PHE 9 27 1 Y 1 D THR 116 ? D THR 10 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #