data_2WAV # _entry.id 2WAV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2WAV PDBE EBI-38815 WWPDB D_1290038815 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2009-11-17 _pdbx_database_PDB_obs_spr.pdb_id 2WXC _pdbx_database_PDB_obs_spr.replace_pdb_id 2WAV _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.entry_id 2WAV _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-02-16 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Neuweiler, H.' 1 'Sharpe, T.D.' 2 'Rutherford, T.J.' 3 'Johnson, C.M.' 4 'Ferguson, N.' 5 'Fersht, A.R.' 6 # _citation.id primary _citation.title 'The Folding Mechanism of Bbl: Plasticity of Transition State Structure Observed within an Ultrafast Folding Protein Family.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 390 _citation.page_first 1060 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19445954 _citation.pdbx_database_id_DOI 10.1016/J.JMB.2009.05.011 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Neuweiler, H.' 1 primary 'Sharpe, T.D.' 2 primary 'Rutherford, T.J.' 3 primary 'Johnson, C.M.' 4 primary 'Allen, M.D.' 5 primary 'Ferguson, N.' 6 primary 'Fersht, A.R.' 7 # _cell.entry_id 2WAV _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2WAV _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description DIHYDROLIPOYLTRANSSUCCINASE _entity.formula_weight 5008.610 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.61 _entity.pdbx_mutation YES _entity.pdbx_fragment 'RESIDUES 109-153' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEHYDROGENASE COMPLEX, E2, DIHYDROLIPOYLLYSINE-RESIDUE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEHYDROGENASE COMPLEX ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSQNNDALSPAIRRLLAEWNLDASAIKGTGVGGRLTREDVEKHLAKA _entity_poly.pdbx_seq_one_letter_code_can GSQNNDALSPAIRRLLAEWNLDASAIKGTGVGGRLTREDVEKHLAKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLN n 1 4 ASN n 1 5 ASN n 1 6 ASP n 1 7 ALA n 1 8 LEU n 1 9 SER n 1 10 PRO n 1 11 ALA n 1 12 ILE n 1 13 ARG n 1 14 ARG n 1 15 LEU n 1 16 LEU n 1 17 ALA n 1 18 GLU n 1 19 TRP n 1 20 ASN n 1 21 LEU n 1 22 ASP n 1 23 ALA n 1 24 SER n 1 25 ALA n 1 26 ILE n 1 27 LYS n 1 28 GLY n 1 29 THR n 1 30 GLY n 1 31 VAL n 1 32 GLY n 1 33 GLY n 1 34 ARG n 1 35 LEU n 1 36 THR n 1 37 ARG n 1 38 GLU n 1 39 ASP n 1 40 VAL n 1 41 GLU n 1 42 LYS n 1 43 HIS n 1 44 LEU n 1 45 ALA n 1 46 LYS n 1 47 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2WAV 1 ? ? 2WAV ? 2 UNP B7M5P0_ECOLX 1 ? ? B7M5P0 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2WAV A 1 ? 2 ? 2WAV 124 ? 125 ? 124 125 2 2 2WAV A 3 ? 47 ? B7M5P0 109 ? 153 ? 126 170 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2WAV _struct_ref_seq_dif.mon_id TRP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 19 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code B7M5P0 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 125 _struct_ref_seq_dif.details 'ENGINEERED MUTATION' _struct_ref_seq_dif.pdbx_auth_seq_num 142 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '95% WATER/5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model ADVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength ? # _pdbx_nmr_refine.entry_id 2WAV _pdbx_nmr_refine.method CNS _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2WAV _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED' # _pdbx_nmr_ensemble.entry_id 2WAV _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 2WAV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.1 'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' ANSIG 3.3 ? 2 # _exptl.entry_id 2WAV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2WAV _struct.title 'The folding mechanism of BBL: Plasticity of transition state structure observed within an ultrafast folding protein family' _struct.pdbx_descriptor 'DIHYDROLIPOYLTRANSSUCCINASE (E.C.2.3.1.61)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2WAV _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;PERIPHERAL SUBUNIT BINDING DOMAIN FAMILY, TEMPERATURE-JUMP FLUORESCENCE SPECTROSCOPY, ULTRAFAST PROTEIN FOLDING, TRANSITION STATE MOVEMENT, TRANSFERASE, ACYLTRANSFERASE, PHI- VALUE ANALYSIS ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? TRP A 19 ? SER A 132 TRP A 142 1 ? 11 HELX_P HELX_P2 2 ASP A 22 ? ILE A 26 ? ASP A 145 ILE A 149 5 ? 5 HELX_P HELX_P3 3 THR A 36 ? LYS A 46 ? THR A 159 LYS A 169 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2WAV _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2WAV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 124 124 GLY GLY A . n A 1 2 SER 2 125 125 SER SER A . n A 1 3 GLN 3 126 126 GLN GLN A . n A 1 4 ASN 4 127 127 ASN ASN A . n A 1 5 ASN 5 128 128 ASN ASN A . n A 1 6 ASP 6 129 129 ASP ASP A . n A 1 7 ALA 7 130 130 ALA ALA A . n A 1 8 LEU 8 131 131 LEU LEU A . n A 1 9 SER 9 132 132 SER SER A . n A 1 10 PRO 10 133 133 PRO PRO A . n A 1 11 ALA 11 134 134 ALA ALA A . n A 1 12 ILE 12 135 135 ILE ILE A . n A 1 13 ARG 13 136 136 ARG ARG A . n A 1 14 ARG 14 137 137 ARG ARG A . n A 1 15 LEU 15 138 138 LEU LEU A . n A 1 16 LEU 16 139 139 LEU LEU A . n A 1 17 ALA 17 140 140 ALA ALA A . n A 1 18 GLU 18 141 141 GLU GLU A . n A 1 19 TRP 19 142 142 TRP TRP A . n A 1 20 ASN 20 143 143 ASN ASN A . n A 1 21 LEU 21 144 144 LEU LEU A . n A 1 22 ASP 22 145 145 ASP ASP A . n A 1 23 ALA 23 146 146 ALA ALA A . n A 1 24 SER 24 147 147 SER SER A . n A 1 25 ALA 25 148 148 ALA ALA A . n A 1 26 ILE 26 149 149 ILE ILE A . n A 1 27 LYS 27 150 150 LYS LYS A . n A 1 28 GLY 28 151 151 GLY GLY A . n A 1 29 THR 29 152 152 THR THR A . n A 1 30 GLY 30 153 153 GLY GLY A . n A 1 31 VAL 31 154 154 VAL VAL A . n A 1 32 GLY 32 155 155 GLY GLY A . n A 1 33 GLY 33 156 156 GLY GLY A . n A 1 34 ARG 34 157 157 ARG ARG A . n A 1 35 LEU 35 158 158 LEU LEU A . n A 1 36 THR 36 159 159 THR THR A . n A 1 37 ARG 37 160 160 ARG ARG A . n A 1 38 GLU 38 161 161 GLU GLU A . n A 1 39 ASP 39 162 162 ASP ASP A . n A 1 40 VAL 40 163 163 VAL VAL A . n A 1 41 GLU 41 164 164 GLU GLU A . n A 1 42 LYS 42 165 165 LYS LYS A . n A 1 43 HIS 43 166 166 HIS HIS A . n A 1 44 LEU 44 167 167 LEU LEU A . n A 1 45 ALA 45 168 168 ALA ALA A . n A 1 46 LYS 46 169 169 LYS LYS A . n A 1 47 ALA 47 170 170 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-24 2 'Structure model' 1 1 2009-11-17 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 2 'Structure model' repository Obsolete ? # _pdbx_entry_details.entry_id 2WAV _pdbx_entry_details.compound_details 'ENGINEERED RESIDUE IN CHAIN A, HIS 125 TO TRP' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'HIS-TRP POINT MUTATION WAS INTRODUCED TO ENABLE FOLDING ANALYSIS' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 6 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 138 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TRP _pdbx_validate_close_contact.auth_seq_id_2 142 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 125 ? ? -60.82 -73.41 2 1 ASN A 127 ? ? -172.68 -45.98 3 1 ASN A 128 ? ? -69.15 94.69 4 1 ALA A 130 ? ? -72.75 -161.20 5 1 LEU A 131 ? ? 63.19 151.33 6 2 SER A 125 ? ? 61.68 153.52 7 2 ASP A 129 ? ? 60.25 161.69 8 2 ALA A 130 ? ? -146.20 -44.36 9 2 THR A 152 ? ? -140.75 42.70 10 2 LYS A 169 ? ? -90.50 -72.21 11 3 ASN A 127 ? ? -140.75 -63.02 12 3 THR A 152 ? ? -154.44 89.78 13 4 SER A 125 ? ? 64.31 -78.74 14 4 ALA A 130 ? ? -152.22 30.02 15 4 PRO A 133 ? ? -57.72 -73.74 16 4 THR A 152 ? ? -92.36 56.60 17 4 VAL A 154 ? ? -97.85 34.32 18 5 GLN A 126 ? ? -144.83 -49.59 19 5 ASN A 128 ? ? 61.26 88.52 20 5 ALA A 130 ? ? -147.14 31.42 21 6 ASN A 127 ? ? -159.57 35.76 22 7 ASN A 143 ? ? 58.71 19.03 23 7 VAL A 154 ? ? -92.47 48.60 24 7 LYS A 169 ? ? -107.59 78.94 25 8 ASN A 128 ? ? -176.22 85.72 26 8 ALA A 130 ? ? -107.82 49.11 27 8 LYS A 150 ? ? -71.60 -168.48 28 9 SER A 125 ? ? -106.30 -60.04 29 9 LEU A 131 ? ? 60.30 -176.55 30 9 THR A 152 ? ? -118.18 58.03 31 10 ASN A 128 ? ? 60.83 -177.93 32 10 LEU A 131 ? ? 59.73 -177.33 33 10 THR A 152 ? ? -95.24 57.17 34 10 LYS A 169 ? ? -70.73 -78.12 35 11 ASN A 127 ? ? -177.44 -39.49 36 11 ASP A 129 ? ? -96.93 44.76 37 11 ALA A 130 ? ? -113.06 -161.57 38 11 LEU A 131 ? ? 62.56 -178.76 39 11 THR A 152 ? ? 59.65 91.14 40 11 VAL A 154 ? ? -149.18 52.94 41 12 ASN A 128 ? ? -152.01 -49.14 42 12 ALA A 130 ? ? -177.59 -39.24 43 12 THR A 152 ? ? -172.58 97.33 44 12 VAL A 154 ? ? -146.98 37.85 45 13 SER A 125 ? ? -66.91 -175.63 46 13 THR A 152 ? ? -152.95 35.21 47 13 VAL A 154 ? ? -97.80 35.26 48 13 LYS A 169 ? ? -98.08 37.63 49 14 GLN A 126 ? ? -105.84 -66.88 50 14 ASN A 127 ? ? -135.43 -48.88 51 14 ASN A 128 ? ? -175.86 37.21 52 14 THR A 152 ? ? -159.54 78.19 53 14 LYS A 169 ? ? -168.16 109.07 54 15 ALA A 130 ? ? -175.10 67.69 55 15 LEU A 131 ? ? -124.96 -164.95 56 15 THR A 152 ? ? 174.48 104.48 57 15 ARG A 157 ? ? -156.80 -59.31 58 15 LEU A 158 ? ? -57.14 109.53 59 15 LYS A 169 ? ? -174.03 113.83 #