data_2WF7 # _entry.id 2WF7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2WF7 PDBE EBI-39351 WWPDB D_1290039351 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1Z4N unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE WITH INHIBITOR BOUNDALPHA-GALACTOSE 1-PHOSPHATE COCRYSTALLIZED WITH FLUORIDE' PDB 1Z4O unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE WITH INHIBITOR BOUNDALPHA-GALACTOSE 1-PHOSPHATE' PDB 2WF6 unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE INHIBITED WITH GLUCOSE-6-PHOSPAHTE AND ALUMINIUM TETRAFLUORIDE' PDB 1O03 unspecified ;STRUCTURE OF PENTAVALENT PHOSPHOROUS INTERMEDIATE OF ANENZYME CATALYZED PHOSPHORYL TRANSFER REACTION OBSERVED ONCOCRYSTALLIZATION WITH GLUCOSE 6-PHOSPHATE ; PDB 2WF5 unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE INHIBITED WITH GLUCOSE-6-PHOSPAHTE AND TRIFLUOROMAGNESATE' PDB 1ZOL unspecified 'NATIVE BETA-PGM' PDB 2WFA unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE INHIBITED WITH BERYLLIUM TRIFLUORIDE, IN AN OPEN CONFORMATION.' PDB 1O08 unspecified ;STRUCTURE OF PENTAVALENT PHOSPHOROUS INTERMEDIATE OF ANENZYME CATALYZED PHOSPHORYL TRANSFER REACTION OBSERVED ONCOCRYSTALLIZATION WITH GLUCOSE 1-PHOSPHATE ; PDB 1LVH unspecified 'THE STRUCTURE OF PHOSPHORYLATED BETA- PHOSPHOGLUCOMUTASEFROM LACTOCCOCUS LACTIS TO 2. 3 ANGSTROM RESOLUTION' PDB 2WF8 unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE INHIBITED WITH GLUCOSE-6-PHOSPHATE, GLUCOSE-1- PHOSPHATE AND BERYLLIUM TRIFLUORIDE' PDB 2WF9 unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE INHIBITED WITH GLUCOSE-6-PHOSPHATE, AND BERYLLIUM TRIFLUORIDE, CRYSTAL FORM 2' PDB 4C4R unspecified 'STRUCTURE OF BETA-PHOSPHOGLUCOMUTASE IN COMPLEX WITH A PHOSPHONATE ANALOGUE OF BETA-GLUCOSE-1-PHOSPHATE AND MAGNESIUM TRIFLUORIDE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2WF7 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-04-03 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bowler, M.W.' 1 'Baxter, N.J.' 2 'Webster, C.E.' 3 'Pollard, S.' 4 'Alizadeh, T.' 5 'Hounslow, A.M.' 6 'Cliff, M.J.' 7 'Bermel, W.' 8 'Williams, N.H.' 9 'Hollfelder, F.' 10 'Blackburn, G.M.' 11 'Waltho, J.P.' 12 # _citation.id primary _citation.title ;Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction. ; _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 111 _citation.page_first 12384 _citation.page_last ? _citation.year 2014 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25104750 _citation.pdbx_database_id_DOI 10.1073/PNAS.1402850111 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jin, Y.' 1 ? primary 'Bhattasali, D.' 2 ? primary 'Pellegrini, E.' 3 ? primary 'Forget, S.M.' 4 ? primary 'Baxter, N.J.' 5 ? primary 'Cliff, M.J.' 6 ? primary 'Bowler, M.W.' 7 ? primary 'Jakeman, D.L.' 8 ? primary 'Blackburn, G.M.' 9 ? primary 'Waltho, J.P.' 10 ? # _cell.entry_id 2WF7 _cell.length_a 37.500 _cell.length_b 54.300 _cell.length_c 104.700 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2WF7 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man BETA-PHOSPHOGLUCOMUTASE 24239.594 1 5.4.2.6 ? ? ? 2 non-polymer syn 'TETRAFLUOROALUMINATE ION' 102.975 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 2 ? ? ? ? 4 non-polymer syn 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose 258.163 1 ? ? ? ? 5 water nat water 18.015 285 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name BETA-PGM # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_seq_one_letter_code_can ;MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNY VKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGV APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 LYS n 1 4 ALA n 1 5 VAL n 1 6 LEU n 1 7 PHE n 1 8 ASP n 1 9 LEU n 1 10 ASP n 1 11 GLY n 1 12 VAL n 1 13 ILE n 1 14 THR n 1 15 ASP n 1 16 THR n 1 17 ALA n 1 18 GLU n 1 19 TYR n 1 20 HIS n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 TRP n 1 25 LYS n 1 26 ALA n 1 27 LEU n 1 28 ALA n 1 29 GLU n 1 30 GLU n 1 31 ILE n 1 32 GLY n 1 33 ILE n 1 34 ASN n 1 35 GLY n 1 36 VAL n 1 37 ASP n 1 38 ARG n 1 39 GLN n 1 40 PHE n 1 41 ASN n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 LYS n 1 46 GLY n 1 47 VAL n 1 48 SER n 1 49 ARG n 1 50 GLU n 1 51 ASP n 1 52 SER n 1 53 LEU n 1 54 GLN n 1 55 LYS n 1 56 ILE n 1 57 LEU n 1 58 ASP n 1 59 LEU n 1 60 ALA n 1 61 ASP n 1 62 LYS n 1 63 LYS n 1 64 VAL n 1 65 SER n 1 66 ALA n 1 67 GLU n 1 68 GLU n 1 69 PHE n 1 70 LYS n 1 71 GLU n 1 72 LEU n 1 73 ALA n 1 74 LYS n 1 75 ARG n 1 76 LYS n 1 77 ASN n 1 78 ASP n 1 79 ASN n 1 80 TYR n 1 81 VAL n 1 82 LYS n 1 83 MET n 1 84 ILE n 1 85 GLN n 1 86 ASP n 1 87 VAL n 1 88 SER n 1 89 PRO n 1 90 ALA n 1 91 ASP n 1 92 VAL n 1 93 TYR n 1 94 PRO n 1 95 GLY n 1 96 ILE n 1 97 LEU n 1 98 GLN n 1 99 LEU n 1 100 LEU n 1 101 LYS n 1 102 ASP n 1 103 LEU n 1 104 ARG n 1 105 SER n 1 106 ASN n 1 107 LYS n 1 108 ILE n 1 109 LYS n 1 110 ILE n 1 111 ALA n 1 112 LEU n 1 113 ALA n 1 114 SER n 1 115 ALA n 1 116 SER n 1 117 LYS n 1 118 ASN n 1 119 GLY n 1 120 PRO n 1 121 PHE n 1 122 LEU n 1 123 LEU n 1 124 GLU n 1 125 ARG n 1 126 MET n 1 127 ASN n 1 128 LEU n 1 129 THR n 1 130 GLY n 1 131 TYR n 1 132 PHE n 1 133 ASP n 1 134 ALA n 1 135 ILE n 1 136 ALA n 1 137 ASP n 1 138 PRO n 1 139 ALA n 1 140 GLU n 1 141 VAL n 1 142 ALA n 1 143 ALA n 1 144 SER n 1 145 LYS n 1 146 PRO n 1 147 ALA n 1 148 PRO n 1 149 ASP n 1 150 ILE n 1 151 PHE n 1 152 ILE n 1 153 ALA n 1 154 ALA n 1 155 ALA n 1 156 HIS n 1 157 ALA n 1 158 VAL n 1 159 GLY n 1 160 VAL n 1 161 ALA n 1 162 PRO n 1 163 SER n 1 164 GLU n 1 165 SER n 1 166 ILE n 1 167 GLY n 1 168 LEU n 1 169 GLU n 1 170 ASP n 1 171 SER n 1 172 GLN n 1 173 ALA n 1 174 GLY n 1 175 ILE n 1 176 GLN n 1 177 ALA n 1 178 ILE n 1 179 LYS n 1 180 ASP n 1 181 SER n 1 182 GLY n 1 183 ALA n 1 184 LEU n 1 185 PRO n 1 186 ILE n 1 187 GLY n 1 188 VAL n 1 189 GLY n 1 190 ARG n 1 191 PRO n 1 192 GLU n 1 193 ASP n 1 194 LEU n 1 195 GLY n 1 196 ASP n 1 197 ASP n 1 198 ILE n 1 199 VAL n 1 200 ILE n 1 201 VAL n 1 202 PRO n 1 203 ASP n 1 204 THR n 1 205 SER n 1 206 HIS n 1 207 TYR n 1 208 THR n 1 209 LEU n 1 210 GLU n 1 211 PHE n 1 212 LEU n 1 213 LYS n 1 214 GLU n 1 215 VAL n 1 216 TRP n 1 217 LEU n 1 218 GLN n 1 219 LYS n 1 220 GLN n 1 221 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 19435 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'LACTOCOCCUS LACTIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1358 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET22B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGMB_LACLA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P71447 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2WF7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 221 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71447 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 221 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 221 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2WF7 ARG A 125 ? UNP P71447 LYS 125 conflict 125 1 1 2WF7 HIS A 206 ? UNP P71447 TYR 206 conflict 206 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALF non-polymer . 'TETRAFLUOROALUMINATE ION' ? 'Al F4 -1' 102.975 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 G7P 'D-saccharide, beta linking' . 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose ? 'C7 H15 O8 P' 258.163 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2WF7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_percent_sol 33.51 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '19-21 % PEG 3350 AND 50 MM MG ACETATE, pH 7.2' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details GE211 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator DIAMOND111 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.933 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.933 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2WF7 _reflns.observed_criterion_sigma_I 3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 1.05 _reflns.number_obs 89213 _reflns.number_all ? _reflns.percent_possible_obs 89.2 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 7.60 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.3 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.05 _reflns_shell.d_res_low 1.08 _reflns_shell.percent_possible_all 55.0 _reflns_shell.Rmerge_I_obs 0.22 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 1.60 _reflns_shell.pdbx_redundancy 1.3 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2WF7 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 84669 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.00 _refine.ls_d_res_high 1.05 _refine.ls_percent_reflns_obs 88.8 _refine.ls_R_factor_obs 0.154 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.153 _refine.ls_R_factor_R_free 0.176 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.000 _refine.ls_number_reflns_R_free 4448 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.954 _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.030 _refine.pdbx_overall_ESU_R_Free 0.030 _refine.overall_SU_ML 0.017 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.748 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1680 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.number_atoms_solvent 285 _refine_hist.number_atoms_total 1988 _refine_hist.d_res_high 1.05 _refine_hist.d_res_low 20.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.009 0.024 ? 1794 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.021 ? 1212 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.383 2.248 ? 2447 'X-RAY DIFFRACTION' ? r_angle_other_deg 1.169 3.082 ? 2985 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.511 5.000 ? 236 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.135 25.823 ? 79 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.187 15.000 ? 318 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 21.681 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.206 0.200 ? 282 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.021 ? 1995 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 326 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.942 1.500 ? 1121 'X-RAY DIFFRACTION' ? r_mcbond_other 0.542 1.500 ? 451 'X-RAY DIFFRACTION' ? r_mcangle_it 1.500 2.000 ? 1811 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 2.047 3.000 ? 673 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.184 4.500 ? 628 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 0.913 3.000 ? 3006 'X-RAY DIFFRACTION' ? r_sphericity_free 4.433 3.000 ? 287 'X-RAY DIFFRACTION' ? r_sphericity_bonded 3.594 3.000 ? 2967 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.05 _refine_ls_shell.d_res_low 1.08 _refine_ls_shell.number_reflns_R_work 3251 _refine_ls_shell.R_factor_R_work 0.2930 _refine_ls_shell.percent_reflns_obs 46.98 _refine_ls_shell.R_factor_R_free 0.2810 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 177 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2WF7 _struct.title 'Structure of Beta-Phosphoglucomutase inhibited with Glucose-6- phosphonate and Aluminium tetrafluoride' _struct.pdbx_descriptor 'BETA-PHOSPHOGLUCOMUTASE (E.C.5.4.2.6)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2WF7 _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'TRANSITION STATE ANALOGUE, HALOACID DEHALOGENASE SUPERFAMILY, ISOMERASE, PHOSPHOTRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 3 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 15 ? ILE A 31 ? ASP A 15 ILE A 31 1 ? 17 HELX_P HELX_P2 2 ASP A 37 ? GLU A 42 ? ASP A 37 GLU A 42 1 ? 6 HELX_P HELX_P3 3 SER A 48 ? ALA A 60 ? SER A 48 ALA A 60 1 ? 13 HELX_P HELX_P4 4 SER A 65 ? ILE A 84 ? SER A 65 ILE A 84 1 ? 20 HELX_P HELX_P5 5 GLN A 85 ? VAL A 87 ? GLN A 85 VAL A 87 5 ? 3 HELX_P HELX_P6 6 SER A 88 ? ASP A 91 ? SER A 88 ASP A 91 5 ? 4 HELX_P HELX_P7 7 GLY A 95 ? ASN A 106 ? GLY A 95 ASN A 106 1 ? 12 HELX_P HELX_P8 8 ASN A 118 ? MET A 126 ? ASN A 118 MET A 126 1 ? 9 HELX_P HELX_P9 9 LEU A 128 ? PHE A 132 ? LEU A 128 PHE A 132 5 ? 5 HELX_P HELX_P10 10 PRO A 148 ? VAL A 158 ? PRO A 148 VAL A 158 1 ? 11 HELX_P HELX_P11 11 ALA A 161 ? SER A 163 ? ALA A 161 SER A 163 5 ? 3 HELX_P HELX_P12 12 SER A 171 ? GLY A 182 ? SER A 171 GLY A 182 1 ? 12 HELX_P HELX_P13 13 ARG A 190 ? GLY A 195 ? ARG A 190 GLY A 195 1 ? 6 HELX_P HELX_P14 14 ASP A 203 ? TYR A 207 ? ASP A 203 TYR A 207 5 ? 5 HELX_P HELX_P15 15 THR A 208 ? GLN A 218 ? THR A 208 GLN A 218 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 8 OD1 ? ? ? 1_555 B ALF . AL ? ? A ASP 8 A ALF 1219 1_555 ? ? ? ? ? ? ? 1.914 ? ? metalc2 metalc ? ? A ASP 8 OD2 ? ? ? 1_555 B ALF . AL ? ? A ASP 8 A ALF 1219 1_555 ? ? ? ? ? ? ? 3.386 ? ? metalc3 metalc ? ? A ASP 8 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 8 A MG 1220 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc4 metalc ? ? A ASP 10 O ? ? ? 1_555 C MG . MG ? ? A ASP 10 A MG 1220 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc5 metalc ? ? A ASP 170 OD1 ? ? ? 1_555 C MG . MG ? ? A ASP 170 A MG 1220 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc6 metalc ? ? B ALF . F4 ? ? ? 1_555 C MG . MG ? ? A ALF 1219 A MG 1220 1_555 ? ? ? ? ? ? ? 2.015 ? ? metalc7 metalc ? ? B ALF . AL ? ? ? 1_555 D G7P . O1 ? ? A ALF 1219 A G7P 1221 1_555 ? ? ? ? ? ? ? 1.986 ? ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1220 A HOH 2240 1_555 ? ? ? ? ? ? ? 2.088 ? ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 1220 A HOH 2241 1_555 ? ? ? ? ? ? ? 2.097 ? ? metalc10 metalc ? ? F HOH . O ? ? ? 1_555 E MG . MG ? ? A HOH 2080 A MG 2801 1_555 ? ? ? ? ? ? ? 2.062 ? ? metalc11 metalc ? ? F HOH . O ? ? ? 4_455 E MG . MG ? ? A HOH 2170 A MG 2801 1_555 ? ? ? ? ? ? ? 2.064 ? ? metalc12 metalc ? ? F HOH . O ? ? ? 4_455 E MG . MG ? ? A HOH 2176 A MG 2801 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc13 metalc ? ? F HOH . O ? ? ? 4_455 E MG . MG ? ? A HOH 2177 A MG 2801 1_555 ? ? ? ? ? ? ? 2.117 ? ? metalc14 metalc ? ? F HOH . O ? ? ? 1_555 E MG . MG ? ? A HOH 2205 A MG 2801 1_555 ? ? ? ? ? ? ? 2.057 ? ? metalc15 metalc ? ? F HOH . O ? ? ? 1_555 E MG . MG ? ? A HOH 2206 A MG 2801 1_555 ? ? ? ? ? ? ? 2.089 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 145 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 145 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 146 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 146 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 11.79 # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? parallel AA 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ALA A 134 ? ILE A 135 ? ALA A 134 ILE A 135 AA 2 LYS A 109 ? LEU A 112 ? LYS A 109 LEU A 112 AA 3 ALA A 4 ? PHE A 7 ? ALA A 4 PHE A 7 AA 4 SER A 165 ? GLU A 169 ? SER A 165 GLU A 169 AA 5 LEU A 184 ? VAL A 188 ? LEU A 184 VAL A 188 AA 6 VAL A 199 ? VAL A 201 ? VAL A 199 VAL A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 O ALA A 134 ? O ALA A 134 N LEU A 112 ? N LEU A 112 AA 2 3 N ALA A 111 ? N ALA A 111 O VAL A 5 ? O VAL A 5 AA 3 4 N LEU A 6 ? N LEU A 6 O ILE A 166 ? O ILE A 166 AA 4 5 N GLY A 167 ? N GLY A 167 O LEU A 184 ? O LEU A 184 AA 5 6 N GLY A 187 ? N GLY A 187 O VAL A 199 ? O VAL A 199 # _database_PDB_matrix.entry_id 2WF7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2WF7 _atom_sites.fract_transf_matrix[1][1] 0.026667 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018416 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009551 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AL C F MG N O P S # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'ASN A 34 HAS WRONG CHIRALITY AT ATOM CA' 2 'ASN A 34 C-ALPHA IS PLANAR' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 LYS 107 107 107 LYS LYS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 PHE 121 121 121 PHE PHE A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 HIS 156 156 156 HIS HIS A . n A 1 157 ALA 157 157 157 ALA ALA A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 ALA 177 177 177 ALA ALA A . n A 1 178 ILE 178 178 178 ILE ILE A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 PRO 191 191 191 PRO PRO A . n A 1 192 GLU 192 192 192 GLU GLU A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ASP 197 197 197 ASP ASP A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 PRO 202 202 202 PRO PRO A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 HIS 206 206 206 HIS HIS A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLU 210 210 210 GLU GLU A . n A 1 211 PHE 211 211 211 PHE PHE A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 GLU 214 214 214 GLU GLU A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 TRP 216 216 216 TRP TRP A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 LYS 219 219 ? ? ? A . n A 1 220 GLN 220 220 ? ? ? A . n A 1 221 LYS 221 221 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ALF 1 1219 1219 ALF ALF A . C 3 MG 1 1220 1220 MG MG A . D 4 G7P 1 1221 1221 G7P G7P A . E 3 MG 1 2801 2801 MG MG A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . F 5 HOH 173 2173 2173 HOH HOH A . F 5 HOH 174 2174 2174 HOH HOH A . F 5 HOH 175 2175 2175 HOH HOH A . F 5 HOH 176 2176 2176 HOH HOH A . F 5 HOH 177 2177 2177 HOH HOH A . F 5 HOH 178 2178 2178 HOH HOH A . F 5 HOH 179 2179 2179 HOH HOH A . F 5 HOH 180 2180 2180 HOH HOH A . F 5 HOH 181 2181 2181 HOH HOH A . F 5 HOH 182 2182 2182 HOH HOH A . F 5 HOH 183 2183 2183 HOH HOH A . F 5 HOH 184 2184 2184 HOH HOH A . F 5 HOH 185 2185 2185 HOH HOH A . F 5 HOH 186 2186 2186 HOH HOH A . F 5 HOH 187 2187 2187 HOH HOH A . F 5 HOH 188 2188 2188 HOH HOH A . F 5 HOH 189 2189 2189 HOH HOH A . F 5 HOH 190 2190 2190 HOH HOH A . F 5 HOH 191 2191 2191 HOH HOH A . F 5 HOH 192 2192 2192 HOH HOH A . F 5 HOH 193 2193 2193 HOH HOH A . F 5 HOH 194 2194 2194 HOH HOH A . F 5 HOH 195 2195 2195 HOH HOH A . F 5 HOH 196 2196 2196 HOH HOH A . F 5 HOH 197 2197 2197 HOH HOH A . F 5 HOH 198 2198 2198 HOH HOH A . F 5 HOH 199 2199 2199 HOH HOH A . F 5 HOH 200 2200 2200 HOH HOH A . F 5 HOH 201 2201 2201 HOH HOH A . F 5 HOH 202 2202 2202 HOH HOH A . F 5 HOH 203 2203 2203 HOH HOH A . F 5 HOH 204 2204 2204 HOH HOH A . F 5 HOH 205 2205 2205 HOH HOH A . F 5 HOH 206 2206 2206 HOH HOH A . F 5 HOH 207 2207 2207 HOH HOH A . F 5 HOH 208 2208 2208 HOH HOH A . F 5 HOH 209 2209 2209 HOH HOH A . F 5 HOH 210 2210 2210 HOH HOH A . F 5 HOH 211 2211 2211 HOH HOH A . F 5 HOH 212 2212 2212 HOH HOH A . F 5 HOH 213 2213 2213 HOH HOH A . F 5 HOH 214 2214 2214 HOH HOH A . F 5 HOH 215 2215 2215 HOH HOH A . F 5 HOH 216 2216 2216 HOH HOH A . F 5 HOH 217 2217 2217 HOH HOH A . F 5 HOH 218 2218 2218 HOH HOH A . F 5 HOH 219 2219 2219 HOH HOH A . F 5 HOH 220 2220 2220 HOH HOH A . F 5 HOH 221 2221 2221 HOH HOH A . F 5 HOH 222 2222 2222 HOH HOH A . F 5 HOH 223 2223 2223 HOH HOH A . F 5 HOH 224 2224 2224 HOH HOH A . F 5 HOH 225 2225 2225 HOH HOH A . F 5 HOH 226 2226 2226 HOH HOH A . F 5 HOH 227 2227 2227 HOH HOH A . F 5 HOH 228 2228 2228 HOH HOH A . F 5 HOH 229 2229 2229 HOH HOH A . F 5 HOH 230 2230 2230 HOH HOH A . F 5 HOH 231 2231 2231 HOH HOH A . F 5 HOH 232 2232 2232 HOH HOH A . F 5 HOH 233 2233 2233 HOH HOH A . F 5 HOH 234 2234 2234 HOH HOH A . F 5 HOH 235 2235 2235 HOH HOH A . F 5 HOH 236 2236 2236 HOH HOH A . F 5 HOH 237 2237 2237 HOH HOH A . F 5 HOH 238 2238 2238 HOH HOH A . F 5 HOH 239 2239 2239 HOH HOH A . F 5 HOH 240 2240 2240 HOH HOH A . F 5 HOH 241 2241 2241 HOH HOH A . F 5 HOH 242 2242 2242 HOH HOH A . F 5 HOH 243 2243 2243 HOH HOH A . F 5 HOH 244 2244 2244 HOH HOH A . F 5 HOH 245 2245 2245 HOH HOH A . F 5 HOH 246 2246 2246 HOH HOH A . F 5 HOH 247 2247 2247 HOH HOH A . F 5 HOH 248 2248 2248 HOH HOH A . F 5 HOH 249 2249 2249 HOH HOH A . F 5 HOH 250 2250 2250 HOH HOH A . F 5 HOH 251 2251 2251 HOH HOH A . F 5 HOH 252 2252 2252 HOH HOH A . F 5 HOH 253 2253 2253 HOH HOH A . F 5 HOH 254 2254 2254 HOH HOH A . F 5 HOH 255 2255 2255 HOH HOH A . F 5 HOH 256 2256 2256 HOH HOH A . F 5 HOH 257 2257 2257 HOH HOH A . F 5 HOH 258 2258 2258 HOH HOH A . F 5 HOH 259 2259 2259 HOH HOH A . F 5 HOH 260 2260 2260 HOH HOH A . F 5 HOH 261 2261 2261 HOH HOH A . F 5 HOH 262 2262 2262 HOH HOH A . F 5 HOH 263 2263 2263 HOH HOH A . F 5 HOH 264 2264 2264 HOH HOH A . F 5 HOH 265 2265 2265 HOH HOH A . F 5 HOH 266 2266 2266 HOH HOH A . F 5 HOH 267 2267 2267 HOH HOH A . F 5 HOH 268 2268 2268 HOH HOH A . F 5 HOH 269 2269 2269 HOH HOH A . F 5 HOH 270 2270 2270 HOH HOH A . F 5 HOH 271 2271 2271 HOH HOH A . F 5 HOH 272 2272 2272 HOH HOH A . F 5 HOH 273 2273 2273 HOH HOH A . F 5 HOH 274 2274 2274 HOH HOH A . F 5 HOH 275 2275 2275 HOH HOH A . F 5 HOH 276 2276 2276 HOH HOH A . F 5 HOH 277 2277 2277 HOH HOH A . F 5 HOH 278 2278 2278 HOH HOH A . F 5 HOH 279 2279 2279 HOH HOH A . F 5 HOH 280 2280 2280 HOH HOH A . F 5 HOH 281 2281 2281 HOH HOH A . F 5 HOH 282 2282 2282 HOH HOH A . F 5 HOH 283 2283 2283 HOH HOH A . F 5 HOH 284 2284 2284 HOH HOH A . F 5 HOH 285 2285 2285 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F1 ? B ALF . ? A ALF 1219 ? 1_555 88.7 ? 2 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F2 ? B ALF . ? A ALF 1219 ? 1_555 88.9 ? 3 F1 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F2 ? B ALF . ? A ALF 1219 ? 1_555 90.9 ? 4 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F3 ? B ALF . ? A ALF 1219 ? 1_555 94.1 ? 5 F1 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F3 ? B ALF . ? A ALF 1219 ? 1_555 87.1 ? 6 F2 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F3 ? B ALF . ? A ALF 1219 ? 1_555 176.4 ? 7 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 93.4 ? 8 F1 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 175.9 ? 9 F2 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 92.6 ? 10 F3 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 89.3 ? 11 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 38.3 ? 12 F1 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 127.0 ? 13 F2 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 90.1 ? 14 F3 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 93.5 ? 15 F4 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 55.1 ? 16 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 O1 ? D G7P . ? A G7P 1221 ? 1_555 172.5 ? 17 F1 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 O1 ? D G7P . ? A G7P 1221 ? 1_555 91.0 ? 18 F2 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 O1 ? D G7P . ? A G7P 1221 ? 1_555 83.6 ? 19 F3 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 O1 ? D G7P . ? A G7P 1221 ? 1_555 93.4 ? 20 F4 ? B ALF . ? A ALF 1219 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 O1 ? D G7P . ? A G7P 1221 ? 1_555 87.3 ? 21 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 AL ? B ALF . ? A ALF 1219 ? 1_555 O1 ? D G7P . ? A G7P 1221 ? 1_555 141.6 ? 22 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? A ASP 10 ? A ASP 10 ? 1_555 90.8 ? 23 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 89.8 ? 24 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 91.0 ? 25 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 86.0 ? 26 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 92.8 ? 27 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 F4 ? B ALF . ? A ALF 1219 ? 1_555 174.4 ? 28 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2240 ? 1_555 88.3 ? 29 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2240 ? 1_555 178.8 ? 30 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2240 ? 1_555 89.9 ? 31 F4 ? B ALF . ? A ALF 1219 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2240 ? 1_555 86.3 ? 32 OD2 ? A ASP 8 ? A ASP 8 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2241 ? 1_555 177.6 ? 33 O ? A ASP 10 ? A ASP 10 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2241 ? 1_555 87.8 ? 34 OD1 ? A ASP 170 ? A ASP 170 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2241 ? 1_555 88.3 ? 35 F4 ? B ALF . ? A ALF 1219 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2241 ? 1_555 96.0 ? 36 O ? F HOH . ? A HOH 2240 ? 1_555 MG ? C MG . ? A MG 1220 ? 1_555 O ? F HOH . ? A HOH 2241 ? 1_555 93.1 ? 37 O ? F HOH . ? A HOH 2080 ? 1_555 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2170 ? 4_455 93.0 ? 38 O ? F HOH . ? A HOH 2080 ? 1_555 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2176 ? 4_455 88.7 ? 39 O ? F HOH . ? A HOH 2170 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2176 ? 4_455 91.2 ? 40 O ? F HOH . ? A HOH 2080 ? 1_555 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2177 ? 4_455 174.5 ? 41 O ? F HOH . ? A HOH 2170 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2177 ? 4_455 91.9 ? 42 O ? F HOH . ? A HOH 2176 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2177 ? 4_455 88.8 ? 43 O ? F HOH . ? A HOH 2080 ? 1_555 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2205 ? 1_555 91.7 ? 44 O ? F HOH . ? A HOH 2170 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2205 ? 1_555 86.2 ? 45 O ? F HOH . ? A HOH 2176 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2205 ? 1_555 177.4 ? 46 O ? F HOH . ? A HOH 2177 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2205 ? 1_555 91.0 ? 47 O ? F HOH . ? A HOH 2080 ? 1_555 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2206 ? 1_555 88.9 ? 48 O ? F HOH . ? A HOH 2170 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2206 ? 1_555 176.7 ? 49 O ? F HOH . ? A HOH 2176 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2206 ? 1_555 91.6 ? 50 O ? F HOH . ? A HOH 2177 ? 4_455 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2206 ? 1_555 86.3 ? 51 O ? F HOH . ? A HOH 2205 ? 1_555 MG ? E MG . ? A MG 2801 ? 1_555 O ? F HOH . ? A HOH 2206 ? 1_555 91.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-05-19 2 'Structure model' 1 1 2014-08-20 3 'Structure model' 1 2 2014-09-10 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Non-polymer description' 5 2 'Structure model' Other 6 2 'Structure model' 'Version format compliance' 7 3 'Structure model' 'Database references' 8 4 'Structure model' Advisory 9 4 'Structure model' 'Derived calculations' 10 4 'Structure model' Other 11 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' database_PDB_caveat 3 4 'Structure model' entity 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_entity_nonpoly 6 4 'Structure model' pdbx_struct_conn_angle 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site 9 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.name' 2 4 'Structure model' '_chem_comp.type' 3 4 'Structure model' '_entity.pdbx_description' 4 4 'Structure model' '_pdbx_database_status.status_code_sf' 5 4 'Structure model' '_pdbx_entity_nonpoly.name' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 20 4 'Structure model' '_pdbx_struct_conn_angle.value' 21 4 'Structure model' '_struct_conn.pdbx_dist_value' 22 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 4 'Structure model' '_struct_conn.ptnr1_symmetry' 29 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 35 4 'Structure model' '_struct_conn.ptnr2_symmetry' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0070 ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 N _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ASN _pdbx_validate_rmsd_angle.auth_seq_id_1 34 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 A _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ASN _pdbx_validate_rmsd_angle.auth_seq_id_2 34 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 A _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ASN _pdbx_validate_rmsd_angle.auth_seq_id_3 34 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 A _pdbx_validate_rmsd_angle.angle_value 127.73 _pdbx_validate_rmsd_angle.angle_target_value 111.00 _pdbx_validate_rmsd_angle.angle_deviation 16.73 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.70 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 9 ? ? -103.52 -64.53 2 1 LEU A 9 ? ? -101.42 -67.35 3 1 VAL A 12 ? ? -120.85 -54.78 4 1 ASP A 15 ? ? -81.47 32.40 5 1 ALA A 113 ? ? -118.04 60.06 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id A _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ASN _pdbx_validate_chiral.auth_seq_id 34 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 219 ? A LYS 219 2 1 Y 1 A GLN 220 ? A GLN 220 3 1 Y 1 A LYS 221 ? A LYS 221 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TETRAFLUOROALUMINATE ION' ALF 3 'MAGNESIUM ION' MG 4 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose G7P 5 water HOH #