data_2WKD # _entry.id 2WKD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.308 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2WKD PDBE EBI-40092 WWPDB D_1290040092 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2WKC _pdbx_database_related.content_type unspecified _pdbx_database_related.details 'CRYSTAL STRUCTURE FROM A SINGLE-STRANDED DNA BINDING PROTEIN FROM THE LACTOCOCCAL PHAGE P2' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2WKD _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-06-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Scaltriti, E.' 1 'Cambillau, C.' 2 'Ortiz-Lombardia, M.' 3 # _citation.id primary _citation.title 'Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.' _citation.journal_abbrev Mol.Microbiol. _citation.journal_volume 73 _citation.page_first 1156 _citation.page_last ? _citation.year 2009 _citation.journal_id_ASTM MOMIEE _citation.country UK _citation.journal_id_ISSN 0950-382X _citation.journal_id_CSD 2007 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19719513 _citation.pdbx_database_id_DOI 10.1111/J.1365-2958.2009.06844.X # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Scaltriti, E.' 1 ? primary 'Tegoni, M.' 2 ? primary 'Rivetti, C.' 3 ? primary 'Launay, H.' 4 ? primary 'Masson, J.Y.' 5 ? primary 'Magadan, A.H.' 6 ? primary 'Tremblay, D.' 7 ? primary 'Moineau, S.' 8 ? primary 'Ramoni, R.' 9 ? primary 'Lichiere, J.' 10 ? primary 'Campanacci, V.' 11 ? primary 'Cambillau, C.' 12 ? primary 'Ortiz-Lombardia, M.' 13 ? # _cell.entry_id 2WKD _cell.length_a 75.740 _cell.length_b 75.740 _cell.length_c 88.040 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2WKD _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ORF34P2 13067.198 1 ? YES 'RESIDUES 15-131' ? 2 water nat water 18.015 26 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAF(MSE)PDFIQ(MSE)GDTVTVSGRVQAKESG EYVNYNFVFPTVEKVFITNDNSSQSQAKQDLFGGSEPIEVNSEDLPF ; _entity_poly.pdbx_seq_one_letter_code_can ;GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFMPDFIQMGDTVTVSGRVQAKESGEYVNYNFV FPTVEKVFITNDNSSQSQAKQDLFGGSEPIEVNSEDLPF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ILE n 1 4 ILE n 1 5 THR n 1 6 VAL n 1 7 THR n 1 8 ALA n 1 9 GLN n 1 10 ALA n 1 11 ASN n 1 12 GLU n 1 13 LYS n 1 14 ASN n 1 15 THR n 1 16 ARG n 1 17 THR n 1 18 VAL n 1 19 SER n 1 20 THR n 1 21 ALA n 1 22 LYS n 1 23 GLY n 1 24 ASP n 1 25 LYS n 1 26 LYS n 1 27 ILE n 1 28 ILE n 1 29 SER n 1 30 VAL n 1 31 PRO n 1 32 LEU n 1 33 PHE n 1 34 GLU n 1 35 LYS n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 SER n 1 40 ASN n 1 41 VAL n 1 42 LYS n 1 43 VAL n 1 44 ALA n 1 45 TYR n 1 46 GLY n 1 47 SER n 1 48 ALA n 1 49 PHE n 1 50 MSE n 1 51 PRO n 1 52 ASP n 1 53 PHE n 1 54 ILE n 1 55 GLN n 1 56 MSE n 1 57 GLY n 1 58 ASP n 1 59 THR n 1 60 VAL n 1 61 THR n 1 62 VAL n 1 63 SER n 1 64 GLY n 1 65 ARG n 1 66 VAL n 1 67 GLN n 1 68 ALA n 1 69 LYS n 1 70 GLU n 1 71 SER n 1 72 GLY n 1 73 GLU n 1 74 TYR n 1 75 VAL n 1 76 ASN n 1 77 TYR n 1 78 ASN n 1 79 PHE n 1 80 VAL n 1 81 PHE n 1 82 PRO n 1 83 THR n 1 84 VAL n 1 85 GLU n 1 86 LYS n 1 87 VAL n 1 88 PHE n 1 89 ILE n 1 90 THR n 1 91 ASN n 1 92 ASP n 1 93 ASN n 1 94 SER n 1 95 SER n 1 96 GLN n 1 97 SER n 1 98 GLN n 1 99 ALA n 1 100 LYS n 1 101 GLN n 1 102 ASP n 1 103 LEU n 1 104 PHE n 1 105 GLY n 1 106 GLY n 1 107 SER n 1 108 GLU n 1 109 PRO n 1 110 ILE n 1 111 GLU n 1 112 VAL n 1 113 ASN n 1 114 SER n 1 115 GLU n 1 116 ASP n 1 117 LEU n 1 118 PRO n 1 119 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'LACTOCOCCUS PHAGE P2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 254252 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'ROSETTA (DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PETG-20A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q09WL7_9CAUD _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q09WL7 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2WKD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q09WL7 _struct_ref_seq.db_align_beg 15 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 118 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2WKD GLY A 1 ? UNP Q09WL7 ? ? 'expression tag' 0 1 1 2WKD THR A 2 ? UNP Q09WL7 ? ? 'expression tag' 1 2 1 2WKD MSE A 50 ? UNP Q09WL7 LEU 62 'engineered mutation' 49 3 1 2WKD MSE A 56 ? UNP Q09WL7 LEU 68 'engineered mutation' 55 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2WKD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.22 _exptl_crystal.density_percent_sol 70.9 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;PROTEIN AT 7 MG/ML IN 10 MM TRIS, 300 MM NACL, 1 MM TCEP, PH 8.0 WAS CRYSTALLIZED BY SITTING-DROP VAPOUR DIFFUSION AGAINST 0.1 M HEPES PH 7.2, 60% MME-PEG550 ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2008-10-30 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 1' _diffrn_source.pdbx_synchrotron_site SOLEIL _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 1' _diffrn_source.pdbx_wavelength 0.976 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2WKD _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 88.04 _reflns.d_resolution_high 2.10 _reflns.number_obs 9205 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 25.79 _reflns.B_iso_Wilson_estimate 40 _reflns.pdbx_redundancy 10.18 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.12 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.44 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.77 _reflns_shell.pdbx_redundancy 10.54 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2WKD _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.ls_number_reflns_obs 9182 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.020 _refine.ls_d_res_high 2.100 _refine.ls_percent_reflns_obs 99.783 _refine.ls_R_factor_obs 0.240 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2386 _refine.ls_R_factor_R_free 0.2562 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.08 _refine.ls_number_reflns_R_free 918 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.935 _refine.correlation_coeff_Fo_to_Fc_free 0.934 _refine.B_iso_mean 55.7 _refine.aniso_B[1][1] 3.152 _refine.aniso_B[2][2] 3.152 _refine.aniso_B[3][3] -4.728 _refine.aniso_B[1][2] 1.576 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.400 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.173 _refine.pdbx_overall_ESU_R_Free 0.155 _refine.overall_SU_ML 0.120 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 10.471 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 610 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 636 _refine_hist.d_res_high 2.100 _refine_hist.d_res_low 44.020 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.011 0.022 ? 618 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.186 1.949 ? 832 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.932 5.000 ? 76 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.812 25.000 ? 24 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 16.688 15.000 ? 111 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 24.773 15.000 ? 2 'X-RAY DIFFRACTION' ? r_chiral_restr 0.089 0.200 ? 101 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.021 ? 440 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.198 0.200 ? 208 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.305 0.200 ? 419 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.111 0.200 ? 34 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.131 0.200 ? 30 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.141 0.200 ? 8 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.626 1.500 ? 390 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.530 2.000 ? 637 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 4.315 3.000 ? 228 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 6.543 4.500 ? 195 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.1 _refine_ls_shell.d_res_low 2.155 _refine_ls_shell.number_reflns_R_work 591 _refine_ls_shell.R_factor_R_work 0.307 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.339 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 67 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2WKD _struct.title 'Crystal structure of a double Ile-to-Met mutant of protein ORF34 from lactococcus phage p2' _struct.pdbx_descriptor ORF34P2 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2WKD _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'SSB, SINGLE-STRANDED DNA BINDING, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A PHE 49 C ? ? ? 1_555 A MSE 50 N ? ? A PHE 48 A MSE 49 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 50 C ? ? ? 1_555 A PRO 51 N ? ? A MSE 49 A PRO 50 1_555 ? ? ? ? ? ? ? 1.350 ? covale3 covale both ? A GLN 55 C ? ? ? 1_555 A MSE 56 N ? ? A GLN 54 A MSE 55 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale both ? A MSE 56 C ? ? ? 1_555 A GLY 57 N ? ? A MSE 55 A GLY 56 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 4 ? GLN A 9 ? ILE A 3 GLN A 8 AA 2 THR A 59 ? ALA A 68 ? THR A 58 ALA A 67 AA 3 TYR A 77 ? VAL A 87 ? TYR A 76 VAL A 86 AA 4 TYR A 45 ? PHE A 49 ? TYR A 44 PHE A 48 AA 5 LYS A 25 ? PRO A 31 ? LYS A 24 PRO A 30 AA 6 THR A 15 ? VAL A 18 ? THR A 14 VAL A 17 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ALA A 8 ? N ALA A 7 O VAL A 60 ? O VAL A 59 AA 2 3 N GLN A 67 ? N GLN A 66 O ASN A 78 ? O ASN A 77 AA 3 4 N TYR A 77 ? N TYR A 76 O TYR A 45 ? O TYR A 44 AA 4 5 N ALA A 48 ? N ALA A 47 O ILE A 28 ? O ILE A 27 AA 5 6 N ILE A 27 ? N ILE A 26 O ARG A 16 ? O ARG A 15 # _database_PDB_matrix.entry_id 2WKD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2WKD _atom_sites.fract_transf_matrix[1][1] 0.013203 _atom_sites.fract_transf_matrix[1][2] 0.007623 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015246 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011358 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 THR 2 1 1 THR THR A . n A 1 3 ILE 3 2 2 ILE ILE A . n A 1 4 ILE 4 3 3 ILE ILE A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 VAL 6 5 5 VAL VAL A . n A 1 7 THR 7 6 6 THR THR A . n A 1 8 ALA 8 7 7 ALA ALA A . n A 1 9 GLN 9 8 8 GLN GLN A . n A 1 10 ALA 10 9 9 ALA ALA A . n A 1 11 ASN 11 10 10 ASN ASN A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 LYS 13 12 12 LYS LYS A . n A 1 14 ASN 14 13 13 ASN ASN A . n A 1 15 THR 15 14 14 THR THR A . n A 1 16 ARG 16 15 15 ARG ARG A . n A 1 17 THR 17 16 16 THR THR A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 THR 20 19 19 THR THR A . n A 1 21 ALA 21 20 20 ALA ALA A . n A 1 22 LYS 22 21 21 LYS LYS A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 ILE 27 26 26 ILE ILE A . n A 1 28 ILE 28 27 27 ILE ILE A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 PRO 31 30 30 PRO PRO A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 PHE 33 32 32 PHE PHE A . n A 1 34 GLU 34 33 33 GLU GLU A . n A 1 35 LYS 35 34 34 LYS LYS A . n A 1 36 GLU 36 35 35 GLU GLU A . n A 1 37 LYS 37 36 ? ? ? A . n A 1 38 GLY 38 37 ? ? ? A . n A 1 39 SER 39 38 ? ? ? A . n A 1 40 ASN 40 39 ? ? ? A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 LYS 42 41 41 LYS LYS A . n A 1 43 VAL 43 42 42 VAL VAL A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 TYR 45 44 44 TYR TYR A . n A 1 46 GLY 46 45 45 GLY GLY A . n A 1 47 SER 47 46 46 SER SER A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 PHE 49 48 48 PHE PHE A . n A 1 50 MSE 50 49 49 MSE MSE A . n A 1 51 PRO 51 50 50 PRO PRO A . n A 1 52 ASP 52 51 51 ASP ASP A . n A 1 53 PHE 53 52 52 PHE PHE A . n A 1 54 ILE 54 53 53 ILE ILE A . n A 1 55 GLN 55 54 54 GLN GLN A . n A 1 56 MSE 56 55 55 MSE MSE A . n A 1 57 GLY 57 56 56 GLY GLY A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 THR 61 60 60 THR THR A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 SER 63 62 62 SER SER A . n A 1 64 GLY 64 63 63 GLY GLY A . n A 1 65 ARG 65 64 64 ARG ARG A . n A 1 66 VAL 66 65 65 VAL VAL A . n A 1 67 GLN 67 66 66 GLN GLN A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 LYS 69 68 68 LYS LYS A . n A 1 70 GLU 70 69 ? ? ? A . n A 1 71 SER 71 70 ? ? ? A . n A 1 72 GLY 72 71 ? ? ? A . n A 1 73 GLU 73 72 ? ? ? A . n A 1 74 TYR 74 73 ? ? ? A . n A 1 75 VAL 75 74 ? ? ? A . n A 1 76 ASN 76 75 75 ASN ASN A . n A 1 77 TYR 77 76 76 TYR TYR A . n A 1 78 ASN 78 77 77 ASN ASN A . n A 1 79 PHE 79 78 78 PHE PHE A . n A 1 80 VAL 80 79 79 VAL VAL A . n A 1 81 PHE 81 80 80 PHE PHE A . n A 1 82 PRO 82 81 81 PRO PRO A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 VAL 84 83 83 VAL VAL A . n A 1 85 GLU 85 84 84 GLU GLU A . n A 1 86 LYS 86 85 85 LYS LYS A . n A 1 87 VAL 87 86 86 VAL VAL A . n A 1 88 PHE 88 87 87 PHE PHE A . n A 1 89 ILE 89 88 88 ILE ILE A . n A 1 90 THR 90 89 ? ? ? A . n A 1 91 ASN 91 90 ? ? ? A . n A 1 92 ASP 92 91 ? ? ? A . n A 1 93 ASN 93 92 ? ? ? A . n A 1 94 SER 94 93 ? ? ? A . n A 1 95 SER 95 94 ? ? ? A . n A 1 96 GLN 96 95 ? ? ? A . n A 1 97 SER 97 96 ? ? ? A . n A 1 98 GLN 98 97 ? ? ? A . n A 1 99 ALA 99 98 ? ? ? A . n A 1 100 LYS 100 99 ? ? ? A . n A 1 101 GLN 101 100 ? ? ? A . n A 1 102 ASP 102 101 ? ? ? A . n A 1 103 LEU 103 102 ? ? ? A . n A 1 104 PHE 104 103 ? ? ? A . n A 1 105 GLY 105 104 ? ? ? A . n A 1 106 GLY 106 105 ? ? ? A . n A 1 107 SER 107 106 ? ? ? A . n A 1 108 GLU 108 107 ? ? ? A . n A 1 109 PRO 109 108 ? ? ? A . n A 1 110 ILE 110 109 ? ? ? A . n A 1 111 GLU 111 110 ? ? ? A . n A 1 112 VAL 112 111 ? ? ? A . n A 1 113 ASN 113 112 ? ? ? A . n A 1 114 SER 114 113 ? ? ? A . n A 1 115 GLU 115 114 ? ? ? A . n A 1 116 ASP 116 115 ? ? ? A . n A 1 117 LEU 117 116 ? ? ? A . n A 1 118 PRO 118 117 ? ? ? A . n A 1 119 PHE 119 118 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 2001 2001 HOH HOH A . B 2 HOH 2 2002 2002 HOH HOH A . B 2 HOH 3 2003 2003 HOH HOH A . B 2 HOH 4 2004 2004 HOH HOH A . B 2 HOH 5 2005 2005 HOH HOH A . B 2 HOH 6 2006 2006 HOH HOH A . B 2 HOH 7 2007 2007 HOH HOH A . B 2 HOH 8 2008 2008 HOH HOH A . B 2 HOH 9 2009 2009 HOH HOH A . B 2 HOH 10 2010 2010 HOH HOH A . B 2 HOH 11 2011 2011 HOH HOH A . B 2 HOH 12 2012 2012 HOH HOH A . B 2 HOH 13 2013 2013 HOH HOH A . B 2 HOH 14 2014 2014 HOH HOH A . B 2 HOH 15 2015 2015 HOH HOH A . B 2 HOH 16 2016 2016 HOH HOH A . B 2 HOH 17 2017 2017 HOH HOH A . B 2 HOH 18 2018 2018 HOH HOH A . B 2 HOH 19 2019 2019 HOH HOH A . B 2 HOH 20 2020 2020 HOH HOH A . B 2 HOH 21 2021 2021 HOH HOH A . B 2 HOH 22 2022 2022 HOH HOH A . B 2 HOH 23 2023 2023 HOH HOH A . B 2 HOH 24 2024 2024 HOH HOH A . B 2 HOH 25 2025 2025 HOH HOH A . B 2 HOH 26 2026 2026 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 50 A MSE 49 ? MET SELENOMETHIONINE 2 A MSE 56 A MSE 55 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1890 ? 1 MORE -5.6 ? 1 'SSA (A^2)' 9720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2003 ? B HOH . 2 1 A HOH 2006 ? B HOH . 3 1 A HOH 2018 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-09-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Refinement description' 3 2 'Structure model' 'Version format compliance' 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Experimental preparation' 7 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' exptl_crystal_grow 2 3 'Structure model' pdbx_database_proc 3 3 'Structure model' pdbx_database_status 4 3 'Structure model' struct_biol 5 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_exptl_crystal_grow.method' 2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined 27.8667 40.7297 -11.5124 0.0594 0.0809 0.1172 -0.0068 0.0348 -0.0125 4.3768 2.4517 10.7160 -0.2883 -6.3759 -0.6177 0.3756 0.2638 0.2304 -0.0658 -0.2522 0.0063 -0.6090 -0.1977 -0.1234 'X-RAY DIFFRACTION' 2 ? refined 33.8712 41.0312 -11.6056 0.1275 0.0380 0.0644 -0.0575 0.0390 -0.0013 10.1362 5.9040 4.4085 -6.0087 -4.0670 2.5774 0.1568 0.1040 0.4702 0.0899 -0.0331 0.0056 -0.4977 0.1584 -0.1238 'X-RAY DIFFRACTION' 3 ? refined 29.7001 37.9781 -12.0228 0.1166 0.1752 0.0931 0.0037 0.0804 -0.0433 4.7478 1.1230 9.7491 2.1547 0.4912 1.4002 0.2140 -0.2237 0.2526 0.0045 -0.1053 0.0935 -0.6686 0.0693 -0.1088 'X-RAY DIFFRACTION' 4 ? refined 30.5797 36.9456 -5.3845 0.0766 0.2305 0.0844 -0.0535 0.0360 -0.0477 3.8688 10.1246 11.7745 4.3793 3.5180 5.3764 0.4853 -0.2822 0.0730 0.4027 -0.2960 -0.3820 0.1636 0.6314 -0.1893 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 'X-RAY DIFFRACTION' 1 1 A 0 ? ? A 15 ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 16 ? ? A 35 ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 40 ? ? A 63 ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 64 ? ? A 88 ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement 5.5.0088 ? 1 ? ? ? ? TRUNCATE 'data scaling' . ? 2 ? ? ? ? SHELX phasing . ? 3 ? ? ? ? # _pdbx_entry_details.entry_id 2WKD _pdbx_entry_details.compound_details ;ENGINEERED RESIDUE IN CHAIN A, LEU 62 TO MSE ENGINEERED RESIDUE IN CHAIN A, LEU 68 TO MSE ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 36 ? A LYS 37 2 1 Y 1 A GLY 37 ? A GLY 38 3 1 Y 1 A SER 38 ? A SER 39 4 1 Y 1 A ASN 39 ? A ASN 40 5 1 Y 1 A GLU 69 ? A GLU 70 6 1 Y 1 A SER 70 ? A SER 71 7 1 Y 1 A GLY 71 ? A GLY 72 8 1 Y 1 A GLU 72 ? A GLU 73 9 1 Y 1 A TYR 73 ? A TYR 74 10 1 Y 1 A VAL 74 ? A VAL 75 11 1 Y 1 A THR 89 ? A THR 90 12 1 Y 1 A ASN 90 ? A ASN 91 13 1 Y 1 A ASP 91 ? A ASP 92 14 1 Y 1 A ASN 92 ? A ASN 93 15 1 Y 1 A SER 93 ? A SER 94 16 1 Y 1 A SER 94 ? A SER 95 17 1 Y 1 A GLN 95 ? A GLN 96 18 1 Y 1 A SER 96 ? A SER 97 19 1 Y 1 A GLN 97 ? A GLN 98 20 1 Y 1 A ALA 98 ? A ALA 99 21 1 Y 1 A LYS 99 ? A LYS 100 22 1 Y 1 A GLN 100 ? A GLN 101 23 1 Y 1 A ASP 101 ? A ASP 102 24 1 Y 1 A LEU 102 ? A LEU 103 25 1 Y 1 A PHE 103 ? A PHE 104 26 1 Y 1 A GLY 104 ? A GLY 105 27 1 Y 1 A GLY 105 ? A GLY 106 28 1 Y 1 A SER 106 ? A SER 107 29 1 Y 1 A GLU 107 ? A GLU 108 30 1 Y 1 A PRO 108 ? A PRO 109 31 1 Y 1 A ILE 109 ? A ILE 110 32 1 Y 1 A GLU 110 ? A GLU 111 33 1 Y 1 A VAL 111 ? A VAL 112 34 1 Y 1 A ASN 112 ? A ASN 113 35 1 Y 1 A SER 113 ? A SER 114 36 1 Y 1 A GLU 114 ? A GLU 115 37 1 Y 1 A ASP 115 ? A ASP 116 38 1 Y 1 A LEU 116 ? A LEU 117 39 1 Y 1 A PRO 117 ? A PRO 118 40 1 Y 1 A PHE 118 ? A PHE 119 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #