data_2WV3 # _entry.id 2WV3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2WV3 PDBE EBI-41394 WWPDB D_1290041394 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2WV3 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2009-10-13 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Soroka, V.' 1 'Owczarek, S.' 2 'Kastrup, J.S.' 3 'Berezin, V.' 4 'Bock, E.' 5 'Gajhede, M.' 6 # _citation.id primary _citation.title 'Neuroplastin-55 Binds to and Signals Through the Fibroblast Growth Factor Receptor' _citation.journal_abbrev 'Faseb J.' _citation.journal_volume 24 _citation.page_first 1139 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM FAJOEC _citation.country US _citation.journal_id_ISSN 0892-6638 _citation.journal_id_CSD 2074 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19952283 _citation.pdbx_database_id_DOI 10.1096/FJ.09-140509 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Owczarek, S.' 1 ? primary 'Kiryushko, D.' 2 ? primary 'Larsen, M.H.' 3 ? primary 'Kastrup, J.S.' 4 ? primary 'Gajhede, M.' 5 ? primary 'Sandi, C.' 6 ? primary 'Berezin, V.' 7 ? primary 'Bock, E.' 8 ? primary 'Soroka, V.' 9 ? # _cell.entry_id 2WV3 _cell.length_a 49.390 _cell.length_b 81.080 _cell.length_c 137.540 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2WV3 _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man NEUROPLASTIN 21585.117 1 ? ? 'IG2 AND IG3 OF NEUROPLASTIN-65, RESIDUES 29-217' ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 3 water nat water 18.015 113 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'STROMAL CELL-DERIVED RECEPTOR 1, GLYCOPROTEIN 55/65, SDR-1, GP55/65, NEUROPLASTIN-55' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QNEPRIVTSEEVIIRDSLLPVTLQCNLTSSSHTLMYSYWTKNGVELTATRKNASNMEYRINKPRAEDSGEYHCVYHFVSA PKANATIEVKAAPDITGHKRSENKNEGQDAMMYCKSVGYPHPEWMWRKKENGVFEEISNSSGRFFIINKENYTELNIVNL QITEDPGEYECNATNSIGSASVSTVLRVRV ; _entity_poly.pdbx_seq_one_letter_code_can ;QNEPRIVTSEEVIIRDSLLPVTLQCNLTSSSHTLMYSYWTKNGVELTATRKNASNMEYRINKPRAEDSGEYHCVYHFVSA PKANATIEVKAAPDITGHKRSENKNEGQDAMMYCKSVGYPHPEWMWRKKENGVFEEISNSSGRFFIINKENYTELNIVNL QITEDPGEYECNATNSIGSASVSTVLRVRV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASN n 1 3 GLU n 1 4 PRO n 1 5 ARG n 1 6 ILE n 1 7 VAL n 1 8 THR n 1 9 SER n 1 10 GLU n 1 11 GLU n 1 12 VAL n 1 13 ILE n 1 14 ILE n 1 15 ARG n 1 16 ASP n 1 17 SER n 1 18 LEU n 1 19 LEU n 1 20 PRO n 1 21 VAL n 1 22 THR n 1 23 LEU n 1 24 GLN n 1 25 CYS n 1 26 ASN n 1 27 LEU n 1 28 THR n 1 29 SER n 1 30 SER n 1 31 SER n 1 32 HIS n 1 33 THR n 1 34 LEU n 1 35 MET n 1 36 TYR n 1 37 SER n 1 38 TYR n 1 39 TRP n 1 40 THR n 1 41 LYS n 1 42 ASN n 1 43 GLY n 1 44 VAL n 1 45 GLU n 1 46 LEU n 1 47 THR n 1 48 ALA n 1 49 THR n 1 50 ARG n 1 51 LYS n 1 52 ASN n 1 53 ALA n 1 54 SER n 1 55 ASN n 1 56 MET n 1 57 GLU n 1 58 TYR n 1 59 ARG n 1 60 ILE n 1 61 ASN n 1 62 LYS n 1 63 PRO n 1 64 ARG n 1 65 ALA n 1 66 GLU n 1 67 ASP n 1 68 SER n 1 69 GLY n 1 70 GLU n 1 71 TYR n 1 72 HIS n 1 73 CYS n 1 74 VAL n 1 75 TYR n 1 76 HIS n 1 77 PHE n 1 78 VAL n 1 79 SER n 1 80 ALA n 1 81 PRO n 1 82 LYS n 1 83 ALA n 1 84 ASN n 1 85 ALA n 1 86 THR n 1 87 ILE n 1 88 GLU n 1 89 VAL n 1 90 LYS n 1 91 ALA n 1 92 ALA n 1 93 PRO n 1 94 ASP n 1 95 ILE n 1 96 THR n 1 97 GLY n 1 98 HIS n 1 99 LYS n 1 100 ARG n 1 101 SER n 1 102 GLU n 1 103 ASN n 1 104 LYS n 1 105 ASN n 1 106 GLU n 1 107 GLY n 1 108 GLN n 1 109 ASP n 1 110 ALA n 1 111 MET n 1 112 MET n 1 113 TYR n 1 114 CYS n 1 115 LYS n 1 116 SER n 1 117 VAL n 1 118 GLY n 1 119 TYR n 1 120 PRO n 1 121 HIS n 1 122 PRO n 1 123 GLU n 1 124 TRP n 1 125 MET n 1 126 TRP n 1 127 ARG n 1 128 LYS n 1 129 LYS n 1 130 GLU n 1 131 ASN n 1 132 GLY n 1 133 VAL n 1 134 PHE n 1 135 GLU n 1 136 GLU n 1 137 ILE n 1 138 SER n 1 139 ASN n 1 140 SER n 1 141 SER n 1 142 GLY n 1 143 ARG n 1 144 PHE n 1 145 PHE n 1 146 ILE n 1 147 ILE n 1 148 ASN n 1 149 LYS n 1 150 GLU n 1 151 ASN n 1 152 TYR n 1 153 THR n 1 154 GLU n 1 155 LEU n 1 156 ASN n 1 157 ILE n 1 158 VAL n 1 159 ASN n 1 160 LEU n 1 161 GLN n 1 162 ILE n 1 163 THR n 1 164 GLU n 1 165 ASP n 1 166 PRO n 1 167 GLY n 1 168 GLU n 1 169 TYR n 1 170 GLU n 1 171 CYS n 1 172 ASN n 1 173 ALA n 1 174 THR n 1 175 ASN n 1 176 SER n 1 177 ILE n 1 178 GLY n 1 179 SER n 1 180 ALA n 1 181 SER n 1 182 VAL n 1 183 SER n 1 184 THR n 1 185 VAL n 1 186 LEU n 1 187 ARG n 1 188 VAL n 1 189 ARG n 1 190 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name RAT _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'RATTUS NORVEGICUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'PICHIA PASTORIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 644223 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain GS115 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'HIS 4' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PPIC9K _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP NPTN_RAT 1 ? ? P97546 ? 2 PDB 2WV3 1 ? ? 2WV3 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2WV3 A 1 ? 189 ? P97546 29 ? 217 ? 1 189 2 2 2WV3 A 190 ? 190 ? 2WV3 190 ? 190 ? 190 190 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2WV3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.95 _exptl_crystal.density_percent_sol 57.98 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;NEUROPLASTIN-55 AT A CONCENTRATION OF 4 MG/ML IN 5 MM SODIUM PHOSPHATE AND 150 MM NACL, PH 7.4, WAS MIXED WITH THE RESERVOIR SOLUTION CONTAINING 13-15% W/V PEG 4000, 0.2 M AMMONIUM SULFATE, AND 0.1 M SODIUM ACETATE, PH 4.6. ; # _diffrn.id 1 _diffrn.ambient_temp 288 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE X12' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline X12 _diffrn_source.pdbx_wavelength 0.934 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2WV3 _reflns.observed_criterion_sigma_I 1.45 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 33.60 _reflns.d_resolution_high 1.95 _reflns.number_obs 20597 _reflns.number_all ? _reflns.percent_possible_obs 99.2 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 8.30 _reflns.B_iso_Wilson_estimate 28.88 _reflns.pdbx_redundancy 7.1 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.06 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.37 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.10 _reflns_shell.pdbx_redundancy 7.3 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2WV3 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 20427 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.45 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 33.601 _refine.ls_d_res_high 1.950 _refine.ls_percent_reflns_obs 99.22 _refine.ls_R_factor_obs 0.2097 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2076 _refine.ls_R_factor_R_free 0.2486 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1044 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 42.83 _refine.aniso_B[1][1] 13.6388 _refine.aniso_B[2][2] 2.0433 _refine.aniso_B[3][3] -15.6822 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.395 _refine.solvent_model_param_bsol 71.633 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.29 _refine.pdbx_overall_phase_error 28.07 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1495 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.number_atoms_solvent 113 _refine_hist.number_atoms_total 1636 _refine_hist.d_res_high 1.950 _refine_hist.d_res_low 33.601 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.006 ? ? 1596 'X-RAY DIFFRACTION' ? f_angle_d 1.057 ? ? 2166 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 16.640 ? ? 621 'X-RAY DIFFRACTION' ? f_chiral_restr 0.071 ? ? 234 'X-RAY DIFFRACTION' ? f_plane_restr 0.004 ? ? 277 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.9501 2.0529 2729 0.2622 99.00 0.3252 . . 142 . . 'X-RAY DIFFRACTION' . 2.0529 2.1815 2721 0.2352 99.00 0.2652 . . 147 . . 'X-RAY DIFFRACTION' . 2.1815 2.3499 2743 0.2280 100.00 0.2775 . . 142 . . 'X-RAY DIFFRACTION' . 2.3499 2.5863 2751 0.2317 100.00 0.3196 . . 158 . . 'X-RAY DIFFRACTION' . 2.5863 2.9603 2772 0.2262 100.00 0.2804 . . 150 . . 'X-RAY DIFFRACTION' . 2.9603 3.7289 2803 0.1871 100.00 0.2507 . . 148 . . 'X-RAY DIFFRACTION' . 3.7289 33.6064 2864 0.1861 98.00 0.1999 . . 157 . . # _struct.entry_id 2WV3 _struct.title 'Neuroplastin-55 binds to and signals through the fibroblast growth factor receptor' _struct.pdbx_descriptor NEUROPLASTIN _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2WV3 _struct_keywords.pdbx_keywords 'CELL ADHESION' _struct_keywords.text ;IGCAM, MEMBRANE, GLYCOPROTEIN, CELL MEMBRANE, CELL ADHESION, TRANSMEMBRANE, DISULFIDE BOND, ALTERNATIVE SPLICING, IMMUNOGLOBULIN DOMAIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 64 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 68 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 64 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 68 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 25 A CYS 73 1_555 ? ? ? ? ? ? ? 2.012 ? ? disulf2 disulf ? ? A CYS 114 SG ? ? ? 1_555 A CYS 171 SG ? ? A CYS 114 A CYS 171 1_555 ? ? ? ? ? ? ? 2.020 ? ? covale1 covale one ? A ASN 26 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 26 A NAG 1201 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation covale2 covale one ? A ASN 139 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 139 A NAG 1203 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 119 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 119 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 120 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 120 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.98 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 3 ? AB ? 5 ? AC ? 4 ? AD ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AB 1 2 ? parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AD 1 2 ? parallel AD 2 3 ? anti-parallel AD 3 4 ? anti-parallel AD 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ARG A 5 ? THR A 8 ? ARG A 5 THR A 8 AA 2 VAL A 21 ? SER A 29 ? VAL A 21 SER A 29 AA 3 ASN A 55 ? ILE A 60 ? ASN A 55 ILE A 60 AB 1 VAL A 12 ? ILE A 13 ? VAL A 12 ILE A 13 AB 2 ALA A 80 ? LYS A 90 ? ALA A 80 LYS A 90 AB 3 GLY A 69 ? PHE A 77 ? GLY A 69 PHE A 77 AB 4 LEU A 34 ? LYS A 41 ? LEU A 34 LYS A 41 AB 5 VAL A 44 ? GLU A 45 ? VAL A 44 GLU A 45 AC 1 ASP A 94 ? HIS A 98 ? ASP A 94 HIS A 98 AC 2 ALA A 110 ? VAL A 117 ? ALA A 110 VAL A 117 AC 3 TYR A 152 ? ILE A 157 ? TYR A 152 ILE A 157 AC 4 PHE A 144 ? ASN A 148 ? PHE A 144 ASN A 148 AD 1 SER A 101 ? ASN A 105 ? SER A 101 ASN A 105 AD 2 SER A 179 ? ARG A 189 ? SER A 179 ARG A 189 AD 3 GLY A 167 ? THR A 174 ? GLY A 167 THR A 174 AD 4 GLU A 123 ? GLU A 130 ? GLU A 123 GLU A 130 AD 5 VAL A 133 ? GLU A 136 ? VAL A 133 GLU A 136 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N VAL A 7 ? N VAL A 7 O ASN A 26 ? O ASN A 26 AA 2 3 N CYS A 25 ? N CYS A 25 O MET A 56 ? O MET A 56 AB 1 2 N VAL A 12 ? N VAL A 12 O GLU A 88 ? O GLU A 88 AB 2 3 N VAL A 89 ? N VAL A 89 O GLY A 69 ? O GLY A 69 AB 3 4 O HIS A 76 ? O HIS A 76 N MET A 35 ? N MET A 35 AB 4 5 N LYS A 41 ? N LYS A 41 O VAL A 44 ? O VAL A 44 AC 1 2 N THR A 96 ? N THR A 96 O LYS A 115 ? O LYS A 115 AC 2 3 N CYS A 114 ? N CYS A 114 O THR A 153 ? O THR A 153 AC 3 4 N ASN A 156 ? N ASN A 156 O PHE A 145 ? O PHE A 145 AD 1 2 N GLU A 102 ? N GLU A 102 O VAL A 185 ? O VAL A 185 AD 2 3 N LEU A 186 ? N LEU A 186 O GLY A 167 ? O GLY A 167 AD 3 4 N THR A 174 ? N THR A 174 O GLU A 123 ? O GLU A 123 AD 4 5 N GLU A 130 ? N GLU A 130 O VAL A 133 ? O VAL A 133 # _database_PDB_matrix.entry_id 2WV3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2WV3 _atom_sites.fract_transf_matrix[1][1] 0.020247 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012333 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007271 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLN 108 108 108 GLN GLN A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 CYS 114 114 114 CYS CYS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 TRP 124 124 124 TRP TRP A . n A 1 125 MET 125 125 125 MET MET A . n A 1 126 TRP 126 126 126 TRP TRP A . n A 1 127 ARG 127 127 127 ARG ARG A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PHE 134 134 134 PHE PHE A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 PHE 144 144 144 PHE PHE A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ASN 151 151 151 ASN ASN A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 ILE 162 162 162 ILE ILE A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 CYS 171 171 171 CYS CYS A . n A 1 172 ASN 172 172 172 ASN ASN A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 THR 174 174 174 THR THR A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 VAL 190 190 190 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 1201 1201 NAG NAG A . C 2 NAG 1 1203 1203 NAG NAG A . D 3 HOH 1 2001 2001 HOH HOH A . D 3 HOH 2 2002 2002 HOH HOH A . D 3 HOH 3 2003 2003 HOH HOH A . D 3 HOH 4 2004 2004 HOH HOH A . D 3 HOH 5 2005 2005 HOH HOH A . D 3 HOH 6 2006 2006 HOH HOH A . D 3 HOH 7 2007 2007 HOH HOH A . D 3 HOH 8 2008 2008 HOH HOH A . D 3 HOH 9 2009 2009 HOH HOH A . D 3 HOH 10 2010 2010 HOH HOH A . D 3 HOH 11 2011 2011 HOH HOH A . D 3 HOH 12 2012 2012 HOH HOH A . D 3 HOH 13 2013 2013 HOH HOH A . D 3 HOH 14 2014 2014 HOH HOH A . D 3 HOH 15 2015 2015 HOH HOH A . D 3 HOH 16 2016 2016 HOH HOH A . D 3 HOH 17 2017 2017 HOH HOH A . D 3 HOH 18 2018 2018 HOH HOH A . D 3 HOH 19 2019 2019 HOH HOH A . D 3 HOH 20 2020 2020 HOH HOH A . D 3 HOH 21 2021 2021 HOH HOH A . D 3 HOH 22 2022 2022 HOH HOH A . D 3 HOH 23 2023 2023 HOH HOH A . D 3 HOH 24 2024 2024 HOH HOH A . D 3 HOH 25 2025 2025 HOH HOH A . D 3 HOH 26 2026 2026 HOH HOH A . D 3 HOH 27 2027 2027 HOH HOH A . D 3 HOH 28 2028 2028 HOH HOH A . D 3 HOH 29 2029 2029 HOH HOH A . D 3 HOH 30 2030 2030 HOH HOH A . D 3 HOH 31 2031 2031 HOH HOH A . D 3 HOH 32 2032 2032 HOH HOH A . D 3 HOH 33 2033 2033 HOH HOH A . D 3 HOH 34 2034 2034 HOH HOH A . D 3 HOH 35 2035 2035 HOH HOH A . D 3 HOH 36 2036 2036 HOH HOH A . D 3 HOH 37 2037 2037 HOH HOH A . D 3 HOH 38 2038 2038 HOH HOH A . D 3 HOH 39 2039 2039 HOH HOH A . D 3 HOH 40 2040 2040 HOH HOH A . D 3 HOH 41 2041 2041 HOH HOH A . D 3 HOH 42 2042 2042 HOH HOH A . D 3 HOH 43 2043 2043 HOH HOH A . D 3 HOH 44 2044 2044 HOH HOH A . D 3 HOH 45 2045 2045 HOH HOH A . D 3 HOH 46 2046 2046 HOH HOH A . D 3 HOH 47 2047 2047 HOH HOH A . D 3 HOH 48 2048 2048 HOH HOH A . D 3 HOH 49 2049 2049 HOH HOH A . D 3 HOH 50 2050 2050 HOH HOH A . D 3 HOH 51 2051 2051 HOH HOH A . D 3 HOH 52 2052 2052 HOH HOH A . D 3 HOH 53 2053 2053 HOH HOH A . D 3 HOH 54 2054 2054 HOH HOH A . D 3 HOH 55 2055 2055 HOH HOH A . D 3 HOH 56 2056 2056 HOH HOH A . D 3 HOH 57 2057 2057 HOH HOH A . D 3 HOH 58 2058 2058 HOH HOH A . D 3 HOH 59 2059 2059 HOH HOH A . D 3 HOH 60 2060 2060 HOH HOH A . D 3 HOH 61 2061 2061 HOH HOH A . D 3 HOH 62 2062 2062 HOH HOH A . D 3 HOH 63 2063 2063 HOH HOH A . D 3 HOH 64 2064 2064 HOH HOH A . D 3 HOH 65 2065 2065 HOH HOH A . D 3 HOH 66 2066 2066 HOH HOH A . D 3 HOH 67 2067 2067 HOH HOH A . D 3 HOH 68 2068 2068 HOH HOH A . D 3 HOH 69 2069 2069 HOH HOH A . D 3 HOH 70 2070 2070 HOH HOH A . D 3 HOH 71 2071 2071 HOH HOH A . D 3 HOH 72 2072 2072 HOH HOH A . D 3 HOH 73 2073 2073 HOH HOH A . D 3 HOH 74 2074 2074 HOH HOH A . D 3 HOH 75 2075 2075 HOH HOH A . D 3 HOH 76 2076 2076 HOH HOH A . D 3 HOH 77 2077 2077 HOH HOH A . D 3 HOH 78 2078 2078 HOH HOH A . D 3 HOH 79 2079 2079 HOH HOH A . D 3 HOH 80 2080 2080 HOH HOH A . D 3 HOH 81 2081 2081 HOH HOH A . D 3 HOH 82 2082 2082 HOH HOH A . D 3 HOH 83 2083 2083 HOH HOH A . D 3 HOH 84 2084 2084 HOH HOH A . D 3 HOH 85 2085 2085 HOH HOH A . D 3 HOH 86 2086 2086 HOH HOH A . D 3 HOH 87 2087 2087 HOH HOH A . D 3 HOH 88 2088 2088 HOH HOH A . D 3 HOH 89 2089 2089 HOH HOH A . D 3 HOH 90 2090 2090 HOH HOH A . D 3 HOH 91 2091 2091 HOH HOH A . D 3 HOH 92 2092 2092 HOH HOH A . D 3 HOH 93 2093 2093 HOH HOH A . D 3 HOH 94 2094 2094 HOH HOH A . D 3 HOH 95 2095 2095 HOH HOH A . D 3 HOH 96 2096 2096 HOH HOH A . D 3 HOH 97 2097 2097 HOH HOH A . D 3 HOH 98 2098 2098 HOH HOH A . D 3 HOH 99 2099 2099 HOH HOH A . D 3 HOH 100 2100 2100 HOH HOH A . D 3 HOH 101 2101 2101 HOH HOH A . D 3 HOH 102 2102 2102 HOH HOH A . D 3 HOH 103 2103 2103 HOH HOH A . D 3 HOH 104 2104 2104 HOH HOH A . D 3 HOH 105 2105 2105 HOH HOH A . D 3 HOH 106 2106 2106 HOH HOH A . D 3 HOH 107 2107 2107 HOH HOH A . D 3 HOH 108 2108 2108 HOH HOH A . D 3 HOH 109 2109 2109 HOH HOH A . D 3 HOH 110 2110 2110 HOH HOH A . D 3 HOH 111 2111 2111 HOH HOH A . D 3 HOH 112 2112 2112 HOH HOH A . D 3 HOH 113 2113 2113 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 26 A ASN 26 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 139 A ASN 139 ? ASN 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 2020 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-15 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-07-24 5 'Structure model' 1 4 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Refinement description' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' Other 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' diffrn_source 2 4 'Structure model' software 3 4 'Structure model' struct_conn 4 5 'Structure model' chem_comp 5 5 'Structure model' entity 6 5 'Structure model' pdbx_chem_comp_identifier 7 5 'Structure model' pdbx_database_status 8 5 'Structure model' pdbx_entity_nonpoly 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_site 11 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 4 'Structure model' '_software.name' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 5 'Structure model' '_chem_comp.name' 5 5 'Structure model' '_chem_comp.type' 6 5 'Structure model' '_entity.pdbx_description' 7 5 'Structure model' '_pdbx_database_status.status_code_sf' 8 5 'Structure model' '_pdbx_entity_nonpoly.name' 9 5 'Structure model' '_struct_conn.pdbx_role' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 HKL2Map phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 ND2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASN _pdbx_validate_close_contact.auth_seq_id_1 26 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O5 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 NAG _pdbx_validate_close_contact.auth_seq_id_2 1201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 52 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -100.56 _pdbx_validate_torsion.psi 71.32 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 1 ? A GLN 1 2 1 Y 1 A ASN 2 ? A ASN 2 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 water HOH #