data_2X2B # _entry.id 2X2B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2X2B PDBE EBI-42419 WWPDB D_1290042419 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1F80 unspecified 'HOLO-(ACYL CARRIER PROTEIN) SYNTHASE IN COMPLEX WITH HOLO-(ACYL CARRIER PROTEIN)' PDB 1HY8 unspecified 'SOLUTION STRUCTURE OF B. SUBTILIS ACYL CARRIER PROTEIN' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2X2B _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-01-12 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bellinzoni, M.' 1 'Martinez, M.A.' 2 'DeMendoza, D.' 3 'Alzari, P.M.' 4 # _citation.id primary _citation.title 'A Novel Role of Malonyl-Acp in Lipid Homeostasis.' _citation.journal_abbrev Biochemistry _citation.journal_volume 49 _citation.page_first 3161 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20201588 _citation.pdbx_database_id_DOI 10.1021/BI100136N # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Martinez, M.A.' 1 primary 'Zaballa, M.E.' 2 primary 'Schaeffer, F.' 3 primary 'Bellinzoni, M.' 4 primary 'Albanesi, D.' 5 primary 'Schujman, G.E.' 6 primary 'Vila, A.J.' 7 primary 'Alzari, P.M.' 8 primary 'De Mendoza, D.' 9 # _cell.entry_id 2X2B _cell.length_a 96.944 _cell.length_b 96.944 _cell.length_c 98.816 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2X2B _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ACYL CARRIER PROTEIN' 8654.493 1 ? ? ? ? 2 non-polymer syn '3-{[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl]sulfanyl}-3-oxopropanoic acid' 444.394 1 ? ? ? ? 3 non-polymer syn 'PLATINUM (II) ION' 195.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ACP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GMADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ _entity_poly.pdbx_seq_one_letter_code_can GMADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ALA n 1 4 ASP n 1 5 THR n 1 6 LEU n 1 7 GLU n 1 8 ARG n 1 9 VAL n 1 10 THR n 1 11 LYS n 1 12 ILE n 1 13 ILE n 1 14 VAL n 1 15 ASP n 1 16 ARG n 1 17 LEU n 1 18 GLY n 1 19 VAL n 1 20 ASP n 1 21 GLU n 1 22 ALA n 1 23 ASP n 1 24 VAL n 1 25 LYS n 1 26 LEU n 1 27 GLU n 1 28 ALA n 1 29 SER n 1 30 PHE n 1 31 LYS n 1 32 GLU n 1 33 ASP n 1 34 LEU n 1 35 GLY n 1 36 ALA n 1 37 ASP n 1 38 SER n 1 39 LEU n 1 40 ASP n 1 41 VAL n 1 42 VAL n 1 43 GLU n 1 44 LEU n 1 45 VAL n 1 46 MET n 1 47 GLU n 1 48 LEU n 1 49 GLU n 1 50 ASP n 1 51 GLU n 1 52 PHE n 1 53 ASP n 1 54 MET n 1 55 GLU n 1 56 ILE n 1 57 SER n 1 58 ASP n 1 59 GLU n 1 60 ASP n 1 61 ALA n 1 62 GLU n 1 63 LYS n 1 64 ILE n 1 65 ALA n 1 66 THR n 1 67 VAL n 1 68 GLY n 1 69 ASP n 1 70 ALA n 1 71 VAL n 1 72 ASN n 1 73 TYR n 1 74 ILE n 1 75 GLN n 1 76 ASN n 1 77 GLN n 1 78 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS SUBTILIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PQE30 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 PDB 2X2B 1 ? ? 2X2B ? 2 UNP ACP_BACSU 1 ? ? P80643 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2X2B A 1 ? 1 ? 2X2B 0 ? 0 ? 0 0 2 2 2X2B A 2 ? 78 ? P80643 1 ? 77 ? 1 77 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PT non-polymer . 'PLATINUM (II) ION' ? 'Pt 2' 195.078 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SXM non-polymer . '3-{[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl]sulfanyl}-3-oxopropanoic acid' 'THIOMALONIC ACID S-{2-[3-(2-HYDROXY-3,3-DIMETHYL-4-PHOSPHONOOXY-BUTYRYLAMINO)-PROPIONYLAMINO]-ETHYL} ESTER' 'C14 H25 N2 O10 P S' 444.394 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2X2B _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 6.89 _exptl_crystal.density_percent_sol 82.2 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '2M (NH4)2SO4, 0.1M CITRATE-PHOSPHATE BUFFER PH 4.2' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2007-11-16 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI CHANNEL-CUT' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.976 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.976 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2X2B _reflns.observed_criterion_sigma_I 5.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 48.50 _reflns.d_resolution_high 2.70 _reflns.number_obs 6824 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 32.40 _reflns.B_iso_Wilson_estimate 69.4 _reflns.pdbx_redundancy 23.1 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.69 _reflns_shell.d_res_low 2.84 _reflns_shell.percent_possible_all 99.2 _reflns_shell.Rmerge_I_obs 0.64 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 5.80 _reflns_shell.pdbx_redundancy 23.8 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2X2B _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.ls_number_reflns_obs 6489 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.47 _refine.ls_d_res_high 2.69 _refine.ls_percent_reflns_obs 99.87 _refine.ls_R_factor_obs 0.21261 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21159 _refine.ls_R_factor_R_free 0.23297 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 327 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.931 _refine.B_iso_mean 27.911 _refine.aniso_B[1][1] 0.15 _refine.aniso_B[2][2] 0.15 _refine.aniso_B[3][3] -0.30 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. RESIDUAL U VALUES ONLY.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.223 _refine.pdbx_overall_ESU_R_Free 0.195 _refine.overall_SU_ML 0.147 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 14.854 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 590 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 605 _refine_hist.d_res_high 2.69 _refine_hist.d_res_low 48.47 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.013 0.022 ? 604 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.503 2.003 ? 816 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 4.705 5.000 ? 75 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 34.858 27.813 ? 32 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 14.405 15.000 ? 113 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 27.838 15.000 ? 2 'X-RAY DIFFRACTION' ? r_chiral_restr 0.103 0.200 ? 99 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 444 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.531 1.500 ? 376 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.093 2.000 ? 606 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.966 3.000 ? 228 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.429 4.500 ? 210 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.690 _refine_ls_shell.d_res_low 2.760 _refine_ls_shell.number_reflns_R_work 461 _refine_ls_shell.R_factor_R_work 0.294 _refine_ls_shell.percent_reflns_obs 98.38 _refine_ls_shell.R_factor_R_free 0.437 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2X2B _struct.title 'Crystal structure of malonyl-ACP (acyl carrier protein) from Bacillus subtilis' _struct.pdbx_descriptor 'ACYL CARRIER PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2X2B _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text 'BIOSYNTHETIC PROTEIN, PHOSPHOPANTETHEINE, FATTY ACID BIOSYNTHESIS, LIPID SYNTHESIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 2 ? GLY A 18 ? MET A 1 GLY A 17 1 ? 17 HELX_P HELX_P2 2 ASP A 20 ? VAL A 24 ? ASP A 19 VAL A 23 5 ? 5 HELX_P HELX_P3 3 ASP A 37 ? PHE A 52 ? ASP A 36 PHE A 51 1 ? 16 HELX_P HELX_P4 4 SER A 57 ? GLU A 62 ? SER A 56 GLU A 61 1 ? 6 HELX_P HELX_P5 5 THR A 66 ? ASN A 76 ? THR A 65 ASN A 75 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id SER _struct_conn.ptnr1_label_seq_id 38 _struct_conn.ptnr1_label_atom_id OG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id SXM _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id P24 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id SER _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id SXM _struct_conn.ptnr2_auth_seq_id 101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.879 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SXM A 101' AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT A 1077' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 ARG A 16 ? ARG A 15 . ? 10_655 ? 2 AC1 9 LYS A 31 ? LYS A 30 . ? 1_555 ? 3 AC1 9 ASP A 37 ? ASP A 36 . ? 1_555 ? 4 AC1 9 SER A 38 ? SER A 37 . ? 1_555 ? 5 AC1 9 GLU A 49 ? GLU A 48 . ? 16_555 ? 6 AC1 9 GLU A 55 ? GLU A 54 . ? 16_555 ? 7 AC1 9 ILE A 56 ? ILE A 55 . ? 16_555 ? 8 AC1 9 ASP A 58 ? ASP A 57 . ? 16_555 ? 9 AC1 9 ALA A 61 ? ALA A 60 . ? 16_555 ? 10 AC2 1 MET A 2 ? MET A 1 . ? 1_555 ? # _database_PDB_matrix.entry_id 2X2B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2X2B _atom_sites.fract_transf_matrix[1][1] 0.010315 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010315 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010120 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P PT S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 1 MET MET A . n A 1 3 ALA 3 2 2 ALA ALA A . n A 1 4 ASP 4 3 3 ASP ASP A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 VAL 9 8 8 VAL VAL A . n A 1 10 THR 10 9 9 THR THR A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 ILE 13 12 12 ILE ILE A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 ASP 15 14 14 ASP ASP A . n A 1 16 ARG 16 15 15 ARG ARG A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 GLY 18 17 17 GLY GLY A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 GLU 21 20 20 GLU GLU A . n A 1 22 ALA 22 21 21 ALA ALA A . n A 1 23 ASP 23 22 22 ASP ASP A . n A 1 24 VAL 24 23 23 VAL VAL A . n A 1 25 LYS 25 24 24 LYS LYS A . n A 1 26 LEU 26 25 25 LEU LEU A . n A 1 27 GLU 27 26 26 GLU GLU A . n A 1 28 ALA 28 27 27 ALA ALA A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 PHE 30 29 29 PHE PHE A . n A 1 31 LYS 31 30 30 LYS LYS A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 LEU 34 33 33 LEU LEU A . n A 1 35 GLY 35 34 34 GLY GLY A . n A 1 36 ALA 36 35 35 ALA ALA A . n A 1 37 ASP 37 36 36 ASP ASP A . n A 1 38 SER 38 37 37 SER SER A . n A 1 39 LEU 39 38 38 LEU LEU A . n A 1 40 ASP 40 39 39 ASP ASP A . n A 1 41 VAL 41 40 40 VAL VAL A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 MET 46 45 45 MET MET A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 LEU 48 47 47 LEU LEU A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 ASP 50 49 49 ASP ASP A . n A 1 51 GLU 51 50 50 GLU GLU A . n A 1 52 PHE 52 51 51 PHE PHE A . n A 1 53 ASP 53 52 52 ASP ASP A . n A 1 54 MET 54 53 53 MET MET A . n A 1 55 GLU 55 54 54 GLU GLU A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 SER 57 56 56 SER SER A . n A 1 58 ASP 58 57 57 ASP ASP A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 ASP 60 59 59 ASP ASP A . n A 1 61 ALA 61 60 60 ALA ALA A . n A 1 62 GLU 62 61 61 GLU GLU A . n A 1 63 LYS 63 62 62 LYS LYS A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 ALA 65 64 64 ALA ALA A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 VAL 67 66 66 VAL VAL A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 ASP 69 68 68 ASP ASP A . n A 1 70 ALA 70 69 69 ALA ALA A . n A 1 71 VAL 71 70 70 VAL VAL A . n A 1 72 ASN 72 71 71 ASN ASN A . n A 1 73 TYR 73 72 72 TYR TYR A . n A 1 74 ILE 74 73 73 ILE ILE A . n A 1 75 GLN 75 74 74 GLN GLN A . n A 1 76 ASN 76 75 75 ASN ASN A . n A 1 77 GLN 77 76 76 GLN GLN A . n A 1 78 GLN 78 77 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SXM 1 101 101 SXM SXM A . C 3 PT 1 1077 1077 PT PT A . D 3 PT 1 1078 1078 PT PT A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2030 ? 1 MORE -90.1 ? 1 'SSA (A^2)' 8840 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_655 -x+3/2,y,-z+3/4 -1.0000000000 0.0000000000 0.0000000000 145.4160000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 74.1120000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-10-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 62.8380 _pdbx_refine_tls.origin_y 1.9260 _pdbx_refine_tls.origin_z 31.0900 _pdbx_refine_tls.T[1][1] 0.0522 _pdbx_refine_tls.T[2][2] 0.1343 _pdbx_refine_tls.T[3][3] 0.5185 _pdbx_refine_tls.T[1][2] 0.0123 _pdbx_refine_tls.T[1][3] -0.0402 _pdbx_refine_tls.T[2][3] 0.0221 _pdbx_refine_tls.L[1][1] 8.2363 _pdbx_refine_tls.L[2][2] 4.2166 _pdbx_refine_tls.L[3][3] 5.8772 _pdbx_refine_tls.L[1][2] 0.6864 _pdbx_refine_tls.L[1][3] 1.5222 _pdbx_refine_tls.L[2][3] 0.1530 _pdbx_refine_tls.S[1][1] -0.0371 _pdbx_refine_tls.S[1][2] -0.0298 _pdbx_refine_tls.S[1][3] -0.0870 _pdbx_refine_tls.S[2][1] 0.0226 _pdbx_refine_tls.S[2][2] 0.0983 _pdbx_refine_tls.S[2][3] -0.3953 _pdbx_refine_tls.S[3][1] 0.0782 _pdbx_refine_tls.S[3][2] 0.3698 _pdbx_refine_tls.S[3][3] -0.0612 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 101 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0106 ? 1 XDS 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SHELX-AUTOSHARP phasing . ? 4 # _pdbx_entry_details.entry_id 2X2B _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;THIOMALONIC ACID S-{2-[3-(2-HYDROXY-3, 3-DIMETHYL-4-PHOSPHONOOXY-BUTYRYLAMINO)-PROPIONYLAMINO]-ETHYL} ESTER ; _pdbx_entry_details.sequence_details 'FIRST GLY RESIDUE IS A PURIFICATION TAG LEFTOVER' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A SXM 101 ? C37 ? B SXM 1 C37 2 1 N 1 A SXM 101 ? C38 ? B SXM 1 C38 3 1 N 1 A SXM 101 ? C39 ? B SXM 1 C39 4 1 N 1 A SXM 101 ? O40 ? B SXM 1 O40 5 1 N 1 A SXM 101 ? N41 ? B SXM 1 N41 6 1 N 1 A SXM 101 ? C42 ? B SXM 1 C42 7 1 N 1 A SXM 101 ? C43 ? B SXM 1 C43 8 1 N 1 A SXM 101 ? S1 ? B SXM 1 S1 9 1 N 1 A SXM 101 ? C1 ? B SXM 1 C1 10 1 N 1 A SXM 101 ? O1 ? B SXM 1 O1 11 1 N 1 A SXM 101 ? C2 ? B SXM 1 C2 12 1 N 1 A SXM 101 ? C3 ? B SXM 1 C3 13 1 N 1 A SXM 101 ? O3A ? B SXM 1 O3A 14 1 N 1 A SXM 101 ? O3B ? B SXM 1 O3B # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A GLN 77 ? A GLN 78 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-{[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl]sulfanyl}-3-oxopropanoic acid' SXM 3 'PLATINUM (II) ION' PT #