data_2X7K # _entry.id 2X7K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.315 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2X7K PDBE EBI-43050 WWPDB D_1290043050 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1BCK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN C' PDB 1C5F unspecified 'CRYSTAL STRUCTURE OF THE CYCLOPHILIN-LIKE DOMAIN FROM BRUGIA MALAYI COMPLEXED WITH CYCLOSPORIN A' PDB 1CSA unspecified 'SOLUTION STRUCTURE OF E.COLI CYCLOPHILIN (F112W) COMPLEXED WITH CYCLOSPORIN A' PDB 1CWA unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A' PDB 1CWB unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 5' PDB 1CWC unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8' PDB 1CWF unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN D' PDB 1CWH unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A MODIFIED AT POSITION 7' PDB 1CWI unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITION 7' PDB 1CWJ unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITIONS 5 AND 7.' PDB 1CWK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN D AT POSITIONS 5 AND 7.' PDB 1CWL unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8' PDB 1CWM unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 8' PDB 1CWO unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH NODIFIED CYCLOSPORIN C AT POSITIONS 1, AND 9' PDB 1CYA unspecified 'SOLUTION STRUCTURE OF HUMAN CYCLOPHILIN COMPLEXED WIYH CYCLOSPORIN A' PDB 1CYB unspecified 'SOLUTION STRUCTURE OF HUMAN CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A' PDB 1CYN unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN B COMPLEXED WITH MODIFIED CYCLOSPORIN A' PDB 1IKF unspecified 'CRYSTAL STRUCTURE OF CTCLOSPORIN-FAB COMPLEX' PDB 1M63 unspecified 'CRYSTAL STRUCTURE OF CALCINEURIN-CYCLOPHILIN-CYCLOSPORIN COMPLEX' PDB 1MF8 unspecified 'CRYSTAL STRUCTURE OF HUMAN CALCINEURIN COMPLEXED WITH HUMAN CYCLOPHILIN AND CYCLOSPORIN A' PDB 1MIK unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 6' PDB 1QNG unspecified 'CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A' PDB 1QNH unspecified 'CRYSTAL STRUCTURE OF PLASMODIUM FALCIPARUM CYCLOPHILIN (DOUBLE MUTANT) COMPLEXED WITH CYCLOSPORIN A' PDB 1XQ7 unspecified 'CRYSTAL STRUCTURE OF TRYPANOSOMA CRUZI CYCLOPHILIN COMPLEXED WITH CYCLOSPORIN A' PDB 2ESL unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN C COMPLEXED WITH CYCLOSPORIN A' PDB 2OJU unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN J COMPLEXED WITH CYCLOSPORIN A' PDB 2POY unspecified 'CRYSTAL STRUCTURE OF CRYPTOSPORIDIUM PARVUM IOWA II CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A' PDB 2RMA unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH CYCLOSPORIN A' PDB 2RMB unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN A COMPLEXED WITH MODIFIED CYCLOSPORIN A AT POSITION 5' PDB 2RMC unspecified 'CRYSTAL STRUCTURE OF MURINE CYCLOPHILIN C COMPLEXED WITH CYCLOSPORIN A' PDB 2WFJ unspecified 'CRYSTAL STRUCTURE OF THE PPIASE DOMAIN OF HUMAN CYCLOPHILIN G COMPLEXED WITH CYCLOSPORIN A' PDB 2X2C unspecified 'CRYSTAL STRUCTURE OF HUMAN ACETYL-CYPA COMPLEXED WITH CYCLOSPORINE A' PDB 2Z6W unspecified 'CRYSTAL STRUCTURE OF HUMAN CYCLOPHILIN D IN COMPLEX WITH CYCLOSPORIN A' PDB 3BO7 unspecified 'CRYSTAL STRUCTURE OF CYCLOSPHILIN A FROM TOXOPLASMA GONDII COMPLEXED WIT CYCLOSPORIN A' PDB 3CYS unspecified 'SOLUTION STRUCTURE OF THE HUMAN CYCLOSPORIN A COMPLEXED WITH CYCLOSPORIN A' PDB 3EOV unspecified 'CRYSTAL STRUCTURE OF CYCLOPHILIN FROM LEISHMANIA DONOVANI COMPLEXED WITH CYCLOSPORIN A' PDB 1XWN unspecified 'SOLUTION STRUCTURE OF CYCLOPHILIN LIKE 1(PPIL1) AND INSIGHTS INTO ITS INTERACTION WITH SKIP' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2X7K _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-03-01 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stegmann, C.M.' 1 'Luehrmann, R.' 2 'Wahl, M.C.' 3 # _citation.id primary _citation.title 'The Crystal Structure of Ppil1 Bound to Cyclosporine a Suggests a Binding Mode for a Linear Epitope of the Skip Protein.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 5 _citation.page_first 13 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20368803 _citation.pdbx_database_id_DOI 10.1371/JOURNAL.PONE.0010013 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stegmann, C.M.' 1 ? primary 'Luehrmann, R.' 2 ? primary 'Wahl, M.C.' 3 ? # _cell.entry_id 2X7K _cell.length_a 103.218 _cell.length_b 35.701 _cell.length_c 45.851 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2X7K _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE-LIKE 1' 18257.805 1 5.2.1.8 ? ? ? 2 polymer syn 'CYCLOSPORIN A' 1220.625 1 ? ? ? ? 3 non-polymer syn 'CADMIUM ION' 112.411 2 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 294 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'PPIASE, ROTAMASE, PPIL1' 2 'CICLOSPORIN, CICLOSPORINE' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSG ; ;MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSG ; A ? 2 'polypeptide(L)' no yes '(DAL)(MLE)(MLE)(MVA)(BMT)(ABA)(SAR)(MLE)V(MLE)A' ALLVTAGLVLA B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 ILE n 1 5 PRO n 1 6 PRO n 1 7 ASP n 1 8 SER n 1 9 TRP n 1 10 GLN n 1 11 PRO n 1 12 PRO n 1 13 ASN n 1 14 VAL n 1 15 TYR n 1 16 LEU n 1 17 GLU n 1 18 THR n 1 19 SER n 1 20 MET n 1 21 GLY n 1 22 ILE n 1 23 ILE n 1 24 VAL n 1 25 LEU n 1 26 GLU n 1 27 LEU n 1 28 TYR n 1 29 TRP n 1 30 LYS n 1 31 HIS n 1 32 ALA n 1 33 PRO n 1 34 LYS n 1 35 THR n 1 36 CYS n 1 37 LYS n 1 38 ASN n 1 39 PHE n 1 40 ALA n 1 41 GLU n 1 42 LEU n 1 43 ALA n 1 44 ARG n 1 45 ARG n 1 46 GLY n 1 47 TYR n 1 48 TYR n 1 49 ASN n 1 50 GLY n 1 51 THR n 1 52 LYS n 1 53 PHE n 1 54 HIS n 1 55 ARG n 1 56 ILE n 1 57 ILE n 1 58 LYS n 1 59 ASP n 1 60 PHE n 1 61 MET n 1 62 ILE n 1 63 GLN n 1 64 GLY n 1 65 GLY n 1 66 ASP n 1 67 PRO n 1 68 THR n 1 69 GLY n 1 70 THR n 1 71 GLY n 1 72 ARG n 1 73 GLY n 1 74 GLY n 1 75 ALA n 1 76 SER n 1 77 ILE n 1 78 TYR n 1 79 GLY n 1 80 LYS n 1 81 GLN n 1 82 PHE n 1 83 GLU n 1 84 ASP n 1 85 GLU n 1 86 LEU n 1 87 HIS n 1 88 PRO n 1 89 ASP n 1 90 LEU n 1 91 LYS n 1 92 PHE n 1 93 THR n 1 94 GLY n 1 95 ALA n 1 96 GLY n 1 97 ILE n 1 98 LEU n 1 99 ALA n 1 100 MET n 1 101 ALA n 1 102 ASN n 1 103 ALA n 1 104 GLY n 1 105 PRO n 1 106 ASP n 1 107 THR n 1 108 ASN n 1 109 GLY n 1 110 SER n 1 111 GLN n 1 112 PHE n 1 113 PHE n 1 114 VAL n 1 115 THR n 1 116 LEU n 1 117 ALA n 1 118 PRO n 1 119 THR n 1 120 GLN n 1 121 TRP n 1 122 LEU n 1 123 ASP n 1 124 GLY n 1 125 LYS n 1 126 HIS n 1 127 THR n 1 128 ILE n 1 129 PHE n 1 130 GLY n 1 131 ARG n 1 132 VAL n 1 133 CYS n 1 134 GLN n 1 135 GLY n 1 136 ILE n 1 137 GLY n 1 138 MET n 1 139 VAL n 1 140 ASN n 1 141 ARG n 1 142 VAL n 1 143 GLY n 1 144 MET n 1 145 VAL n 1 146 GLU n 1 147 THR n 1 148 ASN n 1 149 SER n 1 150 GLN n 1 151 ASP n 1 152 ARG n 1 153 PRO n 1 154 VAL n 1 155 ASP n 1 156 ASP n 1 157 VAL n 1 158 LYS n 1 159 ILE n 1 160 ILE n 1 161 LYS n 1 162 ALA n 1 163 TYR n 1 164 PRO n 1 165 SER n 1 166 GLY n 2 1 DAL n 2 2 MLE n 2 3 MLE n 2 4 MVA n 2 5 BMT n 2 6 ABA n 2 7 SAR n 2 8 MLE n 2 9 VAL n 2 10 MLE n 2 11 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ROSETTA2 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PGEX-6-P1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-6-P1-PPIL1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'TOLYPOCLADIUM INFLATUM' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 29910 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP PPIL1_HUMAN 1 ? ? Q9Y3C6 ? 2 NOR NOR00033 2 ? ? NOR00033 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2X7K A 1 ? 166 ? Q9Y3C6 1 ? 166 ? 1 166 2 2 2X7K B 1 ? 11 ? NOR00033 1 ? 11 ? 1 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ABA 'L-peptide linking' n 'ALPHA-AMINOBUTYRIC ACID' ? 'C4 H9 N O2' 103.120 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BMT 'L-peptide linking' n '4-METHYL-4-[(E)-2-BUTENYL]-4,N-METHYL-THREONINE' ? 'C10 H19 N O3' 201.263 CD non-polymer . 'CADMIUM ION' ? 'Cd 2' 112.411 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DAL 'D-peptide linking' . D-ALANINE ? 'C3 H7 N O2' 89.093 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2' 145.199 MVA 'L-peptide linking' n N-METHYLVALINE ? 'C6 H13 N O2' 131.173 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAR 'peptide linking' n SARCOSINE ? 'C3 H7 N O2' 89.093 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2X7K _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_percent_sol 47 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.2 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES, PH 7.2, 0.7 M SODIUM ACETATE, 15 MM CDCL2 AND 50 MM GUANIDINE-HCL GROWN AT 4DEGC' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2009-04-21 _diffrn_detector.details 'DOUBLE CRYSTAL MONOCHROMATOR WITH 2 SETS OF MIRRORS' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'BESSY BEAMLINE 14.2' _diffrn_source.pdbx_synchrotron_site BESSY _diffrn_source.pdbx_synchrotron_beamline 14.2 _diffrn_source.pdbx_wavelength 0.9 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2X7K _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.15 _reflns.number_obs 62933 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.086 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 8.90 _reflns.B_iso_Wilson_estimate 8.13 _reflns.pdbx_redundancy 6.7 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.15 _reflns_shell.d_res_low 1.25 _reflns_shell.percent_possible_all 99.4 _reflns_shell.Rmerge_I_obs 0.44 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.00 _reflns_shell.pdbx_redundancy 6.1 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2X7K _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 61160 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.277 _refine.ls_d_res_high 1.15 _refine.ls_percent_reflns_obs 99.96 _refine.ls_R_factor_obs 0.1292 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1282 _refine.ls_R_factor_R_free 0.1487 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 3093 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 1.5749 _refine.aniso_B[2][2] 0.9631 _refine.aniso_B[3][3] -2.5380 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.389 _refine.solvent_model_param_bsol 40.022 _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.09 _refine.pdbx_overall_phase_error 11.40 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1355 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 294 _refine_hist.number_atoms_total 1652 _refine_hist.d_res_high 1.15 _refine_hist.d_res_low 34.277 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1455 'X-RAY DIFFRACTION' ? f_angle_d 2.205 ? ? 1987 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 17.997 ? ? 583 'X-RAY DIFFRACTION' ? f_chiral_restr 0.074 ? ? 200 'X-RAY DIFFRACTION' ? f_plane_restr 0.007 ? ? 264 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 1.1496 1.1675 2528 0.1695 99.00 0.2126 . . 152 . . . . 'X-RAY DIFFRACTION' . 1.1675 1.1867 2665 0.1651 100.00 0.1944 . . 125 . . . . 'X-RAY DIFFRACTION' . 1.1867 1.2071 2558 0.1603 100.00 0.1962 . . 148 . . . . 'X-RAY DIFFRACTION' . 1.2071 1.2291 2630 0.1489 100.00 0.1797 . . 135 . . . . 'X-RAY DIFFRACTION' . 1.2291 1.2527 2571 0.1346 100.00 0.1633 . . 133 . . . . 'X-RAY DIFFRACTION' . 1.2527 1.2783 2622 0.1297 100.00 0.1637 . . 140 . . . . 'X-RAY DIFFRACTION' . 1.2783 1.3061 2634 0.1304 100.00 0.1642 . . 119 . . . . 'X-RAY DIFFRACTION' . 1.3061 1.3365 2603 0.1247 100.00 0.1617 . . 121 . . . . 'X-RAY DIFFRACTION' . 1.3365 1.3699 2627 0.1148 100.00 0.1462 . . 153 . . . . 'X-RAY DIFFRACTION' . 1.3699 1.4069 2622 0.1121 100.00 0.1318 . . 135 . . . . 'X-RAY DIFFRACTION' . 1.4069 1.4483 2614 0.1061 100.00 0.1265 . . 137 . . . . 'X-RAY DIFFRACTION' . 1.4483 1.4951 2631 0.1042 100.00 0.1262 . . 158 . . . . 'X-RAY DIFFRACTION' . 1.4951 1.5485 2605 0.0988 100.00 0.1433 . . 142 . . . . 'X-RAY DIFFRACTION' . 1.5485 1.6105 2641 0.0990 100.00 0.1214 . . 128 . . . . 'X-RAY DIFFRACTION' . 1.6105 1.6838 2633 0.1003 100.00 0.1391 . . 134 . . . . 'X-RAY DIFFRACTION' . 1.6838 1.7726 2648 0.1042 100.00 0.1271 . . 157 . . . . 'X-RAY DIFFRACTION' . 1.7726 1.8836 2637 0.1061 100.00 0.1299 . . 157 . . . . 'X-RAY DIFFRACTION' . 1.8836 2.0291 2626 0.1081 100.00 0.1146 . . 150 . . . . 'X-RAY DIFFRACTION' . 2.0291 2.2332 2691 0.1083 100.00 0.1345 . . 156 . . . . 'X-RAY DIFFRACTION' . 2.2332 2.5563 2690 0.1230 100.00 0.1476 . . 127 . . . . 'X-RAY DIFFRACTION' . 2.5563 3.2203 2724 0.1465 100.00 0.1575 . . 143 . . . . 'X-RAY DIFFRACTION' . 3.2203 34.2925 2867 0.1574 100.00 0.1647 . . 143 . . . . # _struct.entry_id 2X7K _struct.title 'The crystal structure of PPIL1 in complex with cyclosporine A suggests a binding mode for SKIP' _struct.pdbx_descriptor 'PEPTIDYL-PROLYL CIS-TRANS ISOMERASE-LIKE 1 (E.C.5.2.1.8), CYCLOSPORIN A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2X7K _struct_keywords.pdbx_keywords ISOMERASE/IMMUNOSUPPRESSANT _struct_keywords.text 'ISOMERASE-IMMUNOSUPPRESSANT COMPLEX, ISOMERASE-CYCLOSPORIN COMPLEX, CYCLOSPORIN A, IMMUNOSUPPRESSANT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 32 ? GLY A 46 ? ALA A 32 GLY A 46 1 ? 15 HELX_P HELX_P2 2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5 HELX_P HELX_P3 3 GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C CD . CD ? ? ? 1_555 A CYS 133 SG ? ? A CD 1167 A CYS 133 3_545 ? ? ? ? ? ? ? 2.539 ? metalc2 metalc ? ? C CD . CD ? ? ? 1_555 A ASP 89 OD1 ? ? A CD 1167 A ASP 89 1_555 ? ? ? ? ? ? ? 2.415 ? metalc3 metalc ? ? C CD . CD ? ? ? 1_555 A ASP 89 OD2 ? ? A CD 1167 A ASP 89 1_555 ? ? ? ? ? ? ? 2.311 ? metalc4 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 1167 A HOH 2190 1_555 ? ? ? ? ? ? ? 2.429 ? metalc5 metalc ? ? C CD . CD ? ? ? 1_555 A HIS 31 NE2 ? ? A CD 1167 A HIS 31 1_555 ? ? ? ? ? ? ? 2.297 ? metalc6 metalc ? ? C CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 1167 A HOH 2087 1_555 ? ? ? ? ? ? ? 2.537 ? metalc7 metalc ? ? D CD . CD ? ? ? 1_555 F HOH . O ? ? A CD 1168 A HOH 2239 1_555 ? ? ? ? ? ? ? 2.480 ? metalc8 metalc ? ? D CD . CD ? ? ? 1_555 A HIS 87 ND1 ? ? A CD 1168 A HIS 87 3_555 ? ? ? ? ? ? ? 2.214 ? metalc9 metalc ? ? D CD . CD ? ? ? 1_555 A CYS 133 SG ? ? A CD 1168 A CYS 133 1_555 ? ? ? ? ? ? ? 2.518 ? metalc10 metalc ? ? D CD . CD ? ? ? 1_555 A GLU 26 OE2 ? ? A CD 1168 A GLU 26 1_555 ? ? ? ? ? ? ? 2.868 ? metalc11 metalc ? ? D CD . CD ? ? ? 1_555 A GLU 26 OE1 ? ? A CD 1168 A GLU 26 1_555 ? ? ? ? ? ? ? 2.161 ? metalc12 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 1169 A HOH 2267 1_554 ? ? ? ? ? ? ? 2.857 ? metalc13 metalc ? ? E NA . NA ? ? ? 1_555 A ASP 7 OD1 ? ? A NA 1169 A ASP 7 1_555 ? ? ? ? ? ? ? 2.902 ? metalc14 metalc ? ? E NA . NA ? ? ? 1_555 A ASP 7 OD2 ? ? A NA 1169 A ASP 7 1_555 ? ? ? ? ? ? ? 2.405 ? covale1 covale both ? B DAL 1 N ? ? ? 1_555 B ALA 11 C ? ? B DAL 1 B ALA 11 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale both ? B DAL 1 C ? ? ? 1_555 B MLE 2 N ? ? B DAL 1 B MLE 2 1_555 ? ? ? ? ? ? ? 1.335 ? covale3 covale both ? B MLE 2 C ? ? ? 1_555 B MLE 3 N ? ? B MLE 2 B MLE 3 1_555 ? ? ? ? ? ? ? 1.344 ? covale4 covale both ? B MLE 3 C ? ? ? 1_555 B MVA 4 N ? ? B MLE 3 B MVA 4 1_555 ? ? ? ? ? ? ? 1.352 ? covale5 covale one ? B MVA 4 C ? ? ? 1_555 B BMT 5 N ? ? B MVA 4 B BMT 5 1_555 ? ? ? ? ? ? ? 1.481 ? covale6 covale both ? B BMT 5 C ? ? ? 1_555 B ABA 6 N ? ? B BMT 5 B ABA 6 1_555 ? ? ? ? ? ? ? 1.339 ? covale7 covale both ? B ABA 6 C ? ? ? 1_555 B SAR 7 N ? ? B ABA 6 B SAR 7 1_555 ? ? ? ? ? ? ? 1.348 ? covale8 covale both ? B SAR 7 C ? ? ? 1_555 B MLE 8 N ? ? B SAR 7 B MLE 8 1_555 ? ? ? ? ? ? ? 1.333 ? covale9 covale both ? B MLE 8 C ? ? ? 1_555 B VAL 9 N ? ? B MLE 8 B VAL 9 1_555 ? ? ? ? ? ? ? 1.331 ? covale10 covale both ? B VAL 9 C ? ? ? 1_555 B MLE 10 N ? ? B VAL 9 B MLE 10 1_555 ? ? ? ? ? ? ? 1.330 ? covale11 covale both ? B MLE 10 C ? ? ? 1_555 B ALA 11 N ? ? B MLE 10 B ALA 11 1_555 ? ? ? ? ? ? ? 1.326 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference metalc ? ? covale ? ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AA 6 7 ? anti-parallel AA 7 8 ? anti-parallel AA 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 THR A 51 ? LYS A 52 ? THR A 51 LYS A 52 AA 2 LYS A 158 ? PRO A 164 ? LYS A 158 PRO A 164 AA 3 ASN A 13 ? THR A 18 ? ASN A 13 THR A 18 AA 4 GLY A 21 ? LEU A 27 ? GLY A 21 LEU A 27 AA 5 ILE A 128 ? GLN A 134 ? ILE A 128 GLN A 134 AA 6 ILE A 97 ? MET A 100 ? ILE A 97 MET A 100 AA 7 PHE A 112 ? THR A 115 ? PHE A 112 THR A 115 AA 8 MET A 61 ? GLY A 64 ? MET A 61 GLY A 64 AA 9 ARG A 55 ? ILE A 57 ? ARG A 55 ILE A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 O THR A 51 ? O THR A 51 N ILE A 159 ? N ILE A 159 AA 2 3 N TYR A 163 ? N TYR A 163 O TYR A 15 ? O TYR A 15 AA 3 4 N THR A 18 ? N THR A 18 O GLY A 21 ? O GLY A 21 AA 4 5 N GLU A 26 ? N GLU A 26 O ARG A 131 ? O ARG A 131 AA 5 6 N PHE A 129 ? N PHE A 129 O LEU A 98 ? O LEU A 98 AA 6 7 N ALA A 99 ? N ALA A 99 O PHE A 113 ? O PHE A 113 AA 7 8 N VAL A 114 ? N VAL A 114 O ILE A 62 ? O ILE A 62 AA 8 9 N GLN A 63 ? N GLN A 63 O ARG A 55 ? O ARG A 55 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CD A 1167' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD A 1168' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA A 1169' AC4 Software ? ? ? ? 25 'BINDING SITE FOR CHAIN B OF CYCLOSPORIN A' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 31 ? HIS A 31 . ? 1_555 ? 2 AC1 5 ASP A 89 ? ASP A 89 . ? 1_555 ? 3 AC1 5 CYS A 133 ? CYS A 133 . ? 3_545 ? 4 AC1 5 HOH F . ? HOH A 2087 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 2190 . ? 1_555 ? 6 AC2 4 GLU A 26 ? GLU A 26 . ? 1_555 ? 7 AC2 4 HIS A 87 ? HIS A 87 . ? 3_555 ? 8 AC2 4 CYS A 133 ? CYS A 133 . ? 1_555 ? 9 AC2 4 HOH F . ? HOH A 2239 . ? 1_555 ? 10 AC3 2 ASP A 7 ? ASP A 7 . ? 1_555 ? 11 AC3 2 HOH F . ? HOH A 2267 . ? 1_554 ? 12 AC4 25 GLU A 17 ? GLU A 17 . ? 1_545 ? 13 AC4 25 ARG A 55 ? ARG A 55 . ? 1_555 ? 14 AC4 25 PHE A 60 ? PHE A 60 . ? 1_555 ? 15 AC4 25 GLN A 63 ? GLN A 63 . ? 1_555 ? 16 AC4 25 GLY A 71 ? GLY A 71 . ? 1_555 ? 17 AC4 25 ALA A 101 ? ALA A 101 . ? 1_555 ? 18 AC4 25 ASN A 102 ? ASN A 102 . ? 1_555 ? 19 AC4 25 GLN A 111 ? GLN A 111 . ? 1_555 ? 20 AC4 25 PHE A 113 ? PHE A 113 . ? 1_555 ? 21 AC4 25 TRP A 121 ? TRP A 121 . ? 1_555 ? 22 AC4 25 HIS A 126 ? HIS A 126 . ? 1_555 ? 23 AC4 25 MET A 144 ? MET A 144 . ? 3_546 ? 24 AC4 25 HOH F . ? HOH A 2032 . ? 1_545 ? 25 AC4 25 HOH F . ? HOH A 2033 . ? 1_545 ? 26 AC4 25 HOH F . ? HOH A 2066 . ? 1_545 ? 27 AC4 25 HOH F . ? HOH A 2137 . ? 1_555 ? 28 AC4 25 HOH F . ? HOH A 2161 . ? 1_555 ? 29 AC4 25 HOH G . ? HOH B 2001 . ? 1_555 ? 30 AC4 25 HOH G . ? HOH B 2002 . ? 1_555 ? 31 AC4 25 HOH G . ? HOH B 2003 . ? 1_555 ? 32 AC4 25 HOH G . ? HOH B 2004 . ? 1_555 ? 33 AC4 25 HOH G . ? HOH B 2005 . ? 1_555 ? 34 AC4 25 HOH G . ? HOH B 2006 . ? 1_555 ? 35 AC4 25 HOH G . ? HOH B 2007 . ? 1_555 ? 36 AC4 25 HOH G . ? HOH B 2008 . ? 1_555 ? # _database_PDB_matrix.entry_id 2X7K _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2X7K _atom_sites.fract_transf_matrix[1][1] 0.009688 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028010 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.021810 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CD H N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 PHE 92 92 92 PHE PHE A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 MET 144 144 144 MET MET A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 THR 147 147 147 THR THR A . n A 1 148 ASN 148 148 148 ASN ASN A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 GLY 166 166 166 GLY GLY A . n B 2 1 DAL 1 1 1 DAL DAL B . n B 2 2 MLE 2 2 2 MLE MLE B . n B 2 3 MLE 3 3 3 MLE MLE B . n B 2 4 MVA 4 4 4 MVA MVA B . n B 2 5 BMT 5 5 5 BMT BMT B . n B 2 6 ABA 6 6 6 ABA ABA B . n B 2 7 SAR 7 7 7 SAR SAR B . n B 2 8 MLE 8 8 8 MLE MLE B . n B 2 9 VAL 9 9 9 VAL VAL B . n B 2 10 MLE 10 10 10 MLE MLE B . n B 2 11 ALA 11 11 11 ALA ALA B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CD 1 1167 1167 CD CD A . D 3 CD 1 1168 1168 CD CD A . E 4 NA 1 1169 1169 NA NA A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . F 5 HOH 173 2173 2173 HOH HOH A . F 5 HOH 174 2174 2174 HOH HOH A . F 5 HOH 175 2175 2175 HOH HOH A . F 5 HOH 176 2176 2176 HOH HOH A . F 5 HOH 177 2177 2177 HOH HOH A . F 5 HOH 178 2178 2178 HOH HOH A . F 5 HOH 179 2179 2179 HOH HOH A . F 5 HOH 180 2180 2180 HOH HOH A . F 5 HOH 181 2181 2181 HOH HOH A . F 5 HOH 182 2182 2182 HOH HOH A . F 5 HOH 183 2183 2183 HOH HOH A . F 5 HOH 184 2184 2184 HOH HOH A . F 5 HOH 185 2185 2185 HOH HOH A . F 5 HOH 186 2186 2186 HOH HOH A . F 5 HOH 187 2187 2187 HOH HOH A . F 5 HOH 188 2188 2188 HOH HOH A . F 5 HOH 189 2189 2189 HOH HOH A . F 5 HOH 190 2190 2190 HOH HOH A . F 5 HOH 191 2191 2191 HOH HOH A . F 5 HOH 192 2192 2192 HOH HOH A . F 5 HOH 193 2193 2193 HOH HOH A . F 5 HOH 194 2194 2194 HOH HOH A . F 5 HOH 195 2195 2195 HOH HOH A . F 5 HOH 196 2196 2196 HOH HOH A . F 5 HOH 197 2197 2197 HOH HOH A . F 5 HOH 198 2198 2198 HOH HOH A . F 5 HOH 199 2199 2199 HOH HOH A . F 5 HOH 200 2200 2200 HOH HOH A . F 5 HOH 201 2201 2201 HOH HOH A . F 5 HOH 202 2202 2202 HOH HOH A . F 5 HOH 203 2203 2203 HOH HOH A . F 5 HOH 204 2204 2204 HOH HOH A . F 5 HOH 205 2205 2205 HOH HOH A . F 5 HOH 206 2206 2206 HOH HOH A . F 5 HOH 207 2207 2207 HOH HOH A . F 5 HOH 208 2208 2208 HOH HOH A . F 5 HOH 209 2209 2209 HOH HOH A . F 5 HOH 210 2210 2210 HOH HOH A . F 5 HOH 211 2211 2211 HOH HOH A . F 5 HOH 212 2212 2212 HOH HOH A . F 5 HOH 213 2213 2213 HOH HOH A . F 5 HOH 214 2214 2214 HOH HOH A . F 5 HOH 215 2215 2215 HOH HOH A . F 5 HOH 216 2216 2216 HOH HOH A . F 5 HOH 217 2217 2217 HOH HOH A . F 5 HOH 218 2218 2218 HOH HOH A . F 5 HOH 219 2219 2219 HOH HOH A . F 5 HOH 220 2220 2220 HOH HOH A . F 5 HOH 221 2221 2221 HOH HOH A . F 5 HOH 222 2222 2222 HOH HOH A . F 5 HOH 223 2223 2223 HOH HOH A . F 5 HOH 224 2224 2224 HOH HOH A . F 5 HOH 225 2225 2225 HOH HOH A . F 5 HOH 226 2226 2226 HOH HOH A . F 5 HOH 227 2227 2227 HOH HOH A . F 5 HOH 228 2228 2228 HOH HOH A . F 5 HOH 229 2229 2229 HOH HOH A . F 5 HOH 230 2230 2230 HOH HOH A . F 5 HOH 231 2231 2231 HOH HOH A . F 5 HOH 232 2232 2232 HOH HOH A . F 5 HOH 233 2233 2233 HOH HOH A . F 5 HOH 234 2234 2234 HOH HOH A . F 5 HOH 235 2235 2235 HOH HOH A . F 5 HOH 236 2236 2236 HOH HOH A . F 5 HOH 237 2237 2237 HOH HOH A . F 5 HOH 238 2238 2238 HOH HOH A . F 5 HOH 239 2239 2239 HOH HOH A . F 5 HOH 240 2240 2240 HOH HOH A . F 5 HOH 241 2241 2241 HOH HOH A . F 5 HOH 242 2242 2242 HOH HOH A . F 5 HOH 243 2243 2243 HOH HOH A . F 5 HOH 244 2244 2244 HOH HOH A . F 5 HOH 245 2245 2245 HOH HOH A . F 5 HOH 246 2246 2246 HOH HOH A . F 5 HOH 247 2247 2247 HOH HOH A . F 5 HOH 248 2248 2248 HOH HOH A . F 5 HOH 249 2249 2249 HOH HOH A . F 5 HOH 250 2250 2250 HOH HOH A . F 5 HOH 251 2251 2251 HOH HOH A . F 5 HOH 252 2252 2252 HOH HOH A . F 5 HOH 253 2253 2253 HOH HOH A . F 5 HOH 254 2254 2254 HOH HOH A . F 5 HOH 255 2255 2255 HOH HOH A . F 5 HOH 256 2256 2256 HOH HOH A . F 5 HOH 257 2257 2257 HOH HOH A . F 5 HOH 258 2258 2258 HOH HOH A . F 5 HOH 259 2259 2259 HOH HOH A . F 5 HOH 260 2260 2260 HOH HOH A . F 5 HOH 261 2261 2261 HOH HOH A . F 5 HOH 262 2262 2262 HOH HOH A . F 5 HOH 263 2263 2263 HOH HOH A . F 5 HOH 264 2264 2264 HOH HOH A . F 5 HOH 265 2265 2265 HOH HOH A . F 5 HOH 266 2266 2266 HOH HOH A . F 5 HOH 267 2267 2267 HOH HOH A . F 5 HOH 268 2268 2268 HOH HOH A . F 5 HOH 269 2269 2269 HOH HOH A . F 5 HOH 270 2270 2270 HOH HOH A . F 5 HOH 271 2271 2271 HOH HOH A . F 5 HOH 272 2272 2272 HOH HOH A . F 5 HOH 273 2273 2273 HOH HOH A . F 5 HOH 274 2274 2274 HOH HOH A . F 5 HOH 275 2275 2275 HOH HOH A . F 5 HOH 276 2276 2276 HOH HOH A . F 5 HOH 277 2277 2277 HOH HOH A . F 5 HOH 278 2278 2278 HOH HOH A . F 5 HOH 279 2279 2279 HOH HOH A . F 5 HOH 280 2280 2280 HOH HOH A . F 5 HOH 281 2281 2281 HOH HOH A . F 5 HOH 282 2282 2282 HOH HOH A . F 5 HOH 283 2283 2283 HOH HOH A . F 5 HOH 284 2284 2284 HOH HOH A . F 5 HOH 285 2285 2285 HOH HOH A . F 5 HOH 286 2286 2286 HOH HOH A . G 5 HOH 1 2001 2001 HOH HOH B . G 5 HOH 2 2002 2002 HOH HOH B . G 5 HOH 3 2003 2003 HOH HOH B . G 5 HOH 4 2004 2004 HOH HOH B . G 5 HOH 5 2005 2005 HOH HOH B . G 5 HOH 6 2006 2006 HOH HOH B . G 5 HOH 7 2007 2007 HOH HOH B . G 5 HOH 8 2008 2008 HOH HOH B . # _pdbx_molecule_features.prd_id PRD_000142 _pdbx_molecule_features.name 'Cyclosporin A' _pdbx_molecule_features.type 'Cyclic peptide' _pdbx_molecule_features.class Immunosuppressant _pdbx_molecule_features.details ;CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE. CYCLIZATION IS ACHIEVED BY LINKING THE N- AND THE C- TERMINI. ; # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_000142 _pdbx_molecule.asym_id B # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B MLE 2 B MLE 2 ? LEU N-METHYLLEUCINE 2 B MLE 3 B MLE 3 ? LEU N-METHYLLEUCINE 3 B MVA 4 B MVA 4 ? VAL N-METHYLVALINE 4 B BMT 5 B BMT 5 ? THR ? 5 B ABA 6 B ABA 6 ? ALA 'ALPHA-AMINOBUTYRIC ACID' 6 B SAR 7 B SAR 7 ? GLY SARCOSINE 7 B MLE 8 B MLE 8 ? LEU N-METHYLLEUCINE 8 B MLE 10 B MLE 10 ? LEU N-METHYLLEUCINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE -21.6 ? 1 'SSA (A^2)' 8100 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2063 ? F HOH . 2 1 A HOH 2163 ? F HOH . 3 1 A HOH 2169 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 133 ? A CYS 133 ? 3_545 CD ? C CD . ? A CD 1167 ? 1_555 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 114.2 ? 2 SG ? A CYS 133 ? A CYS 133 ? 3_545 CD ? C CD . ? A CD 1167 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 103.3 ? 3 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 54.5 ? 4 SG ? A CYS 133 ? A CYS 133 ? 3_545 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2190 ? 1_555 103.1 ? 5 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2190 ? 1_555 136.2 ? 6 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2190 ? 1_555 96.1 ? 7 SG ? A CYS 133 ? A CYS 133 ? 3_545 CD ? C CD . ? A CD 1167 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 98.5 ? 8 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 97.6 ? 9 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 149.8 ? 10 O ? F HOH . ? A HOH 2190 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 98.9 ? 11 SG ? A CYS 133 ? A CYS 133 ? 3_545 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2087 ? 1_555 156.7 ? 12 OD1 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2087 ? 1_555 88.5 ? 13 OD2 ? A ASP 89 ? A ASP 89 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2087 ? 1_555 84.9 ? 14 O ? F HOH . ? A HOH 2190 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2087 ? 1_555 53.9 ? 15 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 CD ? C CD . ? A CD 1167 ? 1_555 O ? F HOH . ? A HOH 2087 ? 1_555 83.1 ? 16 O ? F HOH . ? A HOH 2239 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 ND1 ? A HIS 87 ? A HIS 87 ? 3_555 93.3 ? 17 O ? F HOH . ? A HOH 2239 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 SG ? A CYS 133 ? A CYS 133 ? 1_555 109.9 ? 18 ND1 ? A HIS 87 ? A HIS 87 ? 3_555 CD ? D CD . ? A CD 1168 ? 1_555 SG ? A CYS 133 ? A CYS 133 ? 1_555 112.3 ? 19 O ? F HOH . ? A HOH 2239 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 OE2 ? A GLU 26 ? A GLU 26 ? 1_555 141.6 ? 20 ND1 ? A HIS 87 ? A HIS 87 ? 3_555 CD ? D CD . ? A CD 1168 ? 1_555 OE2 ? A GLU 26 ? A GLU 26 ? 1_555 104.7 ? 21 SG ? A CYS 133 ? A CYS 133 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 OE2 ? A GLU 26 ? A GLU 26 ? 1_555 94.3 ? 22 O ? F HOH . ? A HOH 2239 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 OE1 ? A GLU 26 ? A GLU 26 ? 1_555 94.5 ? 23 ND1 ? A HIS 87 ? A HIS 87 ? 3_555 CD ? D CD . ? A CD 1168 ? 1_555 OE1 ? A GLU 26 ? A GLU 26 ? 1_555 136.0 ? 24 SG ? A CYS 133 ? A CYS 133 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 OE1 ? A GLU 26 ? A GLU 26 ? 1_555 105.4 ? 25 OE2 ? A GLU 26 ? A GLU 26 ? 1_555 CD ? D CD . ? A CD 1168 ? 1_555 OE1 ? A GLU 26 ? A GLU 26 ? 1_555 49.4 ? 26 O ? F HOH . ? A HOH 2267 ? 1_554 NA ? E NA . ? A NA 1169 ? 1_555 OD1 ? A ASP 7 ? A ASP 7 ? 1_555 148.5 ? 27 O ? F HOH . ? A HOH 2267 ? 1_554 NA ? E NA . ? A NA 1169 ? 1_555 OD2 ? A ASP 7 ? A ASP 7 ? 1_555 106.4 ? 28 OD1 ? A ASP 7 ? A ASP 7 ? 1_555 NA ? E NA . ? A NA 1169 ? 1_555 OD2 ? A ASP 7 ? A ASP 7 ? 1_555 48.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-11-30 4 'Structure model' 1 3 2019-05-08 5 'Structure model' 1 4 2019-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' 5 2 'Structure model' 'Version format compliance' 6 3 'Structure model' Other 7 4 'Structure model' 'Data collection' 8 4 'Structure model' 'Derived calculations' 9 4 'Structure model' 'Experimental preparation' 10 4 'Structure model' Other 11 5 'Structure model' 'Data collection' 12 5 'Structure model' 'Experimental preparation' 13 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' exptl_crystal_grow 2 4 'Structure model' pdbx_database_proc 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' struct_conn 5 5 'Structure model' exptl_crystal_grow 6 5 'Structure model' pdbx_database_status 7 5 'Structure model' reflns 8 5 'Structure model' reflns_shell # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_exptl_crystal_grow.temp' 2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 5 'Structure model' '_exptl_crystal_grow.method' 5 5 'Structure model' '_pdbx_database_status.status_code_sf' 6 5 'Structure model' '_reflns.pdbx_Rmerge_I_obs' 7 5 'Structure model' '_reflns_shell.Rmerge_I_obs' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language PHENIX refinement '(PHENIX.REFINE)' ? 1 ? ? ? ? XDS 'data reduction' . ? 2 ? ? ? ? SCALA 'data scaling' . ? 3 ? ? ? ? SHELXD phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 2X7K _pdbx_entry_details.compound_details ;CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE. HERE, CYCLOSPORIN A IS REPRESENTED BY THE SEQUENCE (SEQRES) GROUP: 1 NAME: CYCLOSPORIN A CHAIN: B COMPONENT_1: PEPTIDE LIKE SEQUENCE RESIDUES 1 TO 11 DESCRIPTION: CYCLOSPORIN IS A CYCLIC UNDECAPEPTIDE. CYCLIZATION IS ACHIEVED BY LINKING THE N- AND THE C- TERMINI. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C B ABA 6 ? ? H B SAR 7 ? ? 0.66 2 1 O A HOH 2209 ? ? O A HOH 2210 ? ? 1.96 3 1 O A HOH 2050 ? ? O A HOH 2051 ? ? 2.02 4 1 O A ALA 3 ? ? O A HOH 2001 ? ? 2.06 5 1 O A HOH 2209 ? ? O A HOH 2213 ? ? 2.06 6 1 O A HOH 2002 ? ? O A HOH 2003 ? ? 2.11 7 1 O A HOH 2165 ? ? O A HOH 2172 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2010 ? ? 1_555 O A HOH 2010 ? ? 2_555 1.98 2 1 O A HOH 2002 ? ? 1_555 O A HOH 2010 ? ? 2_555 2.01 3 1 O A HOH 2051 ? ? 1_555 O A HOH 2236 ? ? 1_565 2.13 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 B _pdbx_validate_rmsd_bond.auth_comp_id_1 MVA _pdbx_validate_rmsd_bond.auth_seq_id_1 4 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 B _pdbx_validate_rmsd_bond.auth_comp_id_2 BMT _pdbx_validate_rmsd_bond.auth_seq_id_2 5 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.481 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation 0.145 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 89 ? ? CG A ASP 89 ? ? OD1 A ASP 89 ? ? 124.32 118.30 6.02 0.90 N 2 1 O B MVA 4 ? ? C B MVA 4 ? ? N B BMT 5 ? ? 112.73 122.70 -9.97 1.60 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 4 ? A 55.73 137.48 2 1 ILE A 4 ? B 63.56 133.72 3 1 PHE A 60 ? ? -126.74 -81.43 4 1 THR A 119 ? ? -142.14 56.67 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2047 ? 5.94 . 2 1 O ? A HOH 2103 ? 6.33 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CADMIUM ION' CD 4 'SODIUM ION' NA 5 water HOH #