data_2XFD # _entry.id 2XFD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2XFD PDBE EBI-44026 WWPDB D_1290044026 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2XFE unspecified 'VCBM60 IN COMPLEX WITH GALACTOBIOSE' PDB 2XHH unspecified 'CIRCULAR PERMUTATION PROVIDES AN EVOLUTIONARY LINK BETWEEN TWO FAMILIES OF CALCIUM-DEPENDENT CARBOHYDRATE BINDING MODULES' PDB 2XHJ unspecified ;CIRCULAR PERMUTATION PROVIDES AN EVOLUTIONARY LINK BETWEEN TWO FAMILIES OF CALCIUM-DEPENDENT CARBOHYDRATE BINDING MODULES. SEMET FORM OF VCBM60. ; # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XFD _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-05-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Montanier, C.' 1 'Flint, J.E.' 2 'Bolam, D.N.' 3 'Xie, H.' 4 'Liu, Z.' 5 'Rogowski, A.' 6 'Weiner, D.P.' 7 'Nurizzo, D.' 8 'Roberts, S.M.' 9 'Turkenburg, J.P.' 10 'Davies, G.J.' 11 'Gilbert, H.J.' 12 # _citation.id primary _citation.title 'Circular Permutation Provides an Evolutionary Link between Two Families of Calcium-Dependent Carbohydrate Binding Modules.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 285 _citation.page_first 31742 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20659893 _citation.pdbx_database_id_DOI 10.1074/JBC.M110.142133 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Montanier, C.' 1 ? primary 'Flint, J.E.' 2 ? primary 'Bolam, D.N.' 3 ? primary 'Xie, H.' 4 ? primary 'Liu, Z.' 5 ? primary 'Rogowski, A.' 6 ? primary 'Weiner, D.P.' 7 ? primary 'Ratnaparkhe, S.' 8 ? primary 'Nurizzo, D.' 9 ? primary 'Roberts, S.M.' 10 ? primary 'Turkenburg, J.P.' 11 ? primary 'Davies, G.J.' 12 ? primary 'Gilbert, H.J.' 13 ? # _cell.entry_id 2XFD _cell.length_a 29.610 _cell.length_b 41.990 _cell.length_c 80.080 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XFD _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'CARBOHYDRATE BINDING MODULE' 11944.895 1 ? ? ? ? 2 branched man 'beta-D-glucopyranose-(1-4)-beta-D-glucopyranose' 342.297 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 172 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 VCBM60 2 beta-cellobiose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNSITVRARGVNGQESVSLQVGGTTVQTWTLTTAMQDYTASTSLTGEIRVAFTNDATGRDVQVDYIVVNGQTRQAENQS VNTGVWANNQCGGSGNSEWLHCNGYISFGNVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNSITVRARGVNGQESVSLQVGGTTVQTWTLTTAMQDYTASTSLTGEIRVAFTNDATGRDVQVDYIVVNGQTRQAENQS VNTGVWANNQCGGSGNSEWLHCNGYISFGNVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 SER n 1 5 ILE n 1 6 THR n 1 7 VAL n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 GLY n 1 12 VAL n 1 13 ASN n 1 14 GLY n 1 15 GLN n 1 16 GLU n 1 17 SER n 1 18 VAL n 1 19 SER n 1 20 LEU n 1 21 GLN n 1 22 VAL n 1 23 GLY n 1 24 GLY n 1 25 THR n 1 26 THR n 1 27 VAL n 1 28 GLN n 1 29 THR n 1 30 TRP n 1 31 THR n 1 32 LEU n 1 33 THR n 1 34 THR n 1 35 ALA n 1 36 MET n 1 37 GLN n 1 38 ASP n 1 39 TYR n 1 40 THR n 1 41 ALA n 1 42 SER n 1 43 THR n 1 44 SER n 1 45 LEU n 1 46 THR n 1 47 GLY n 1 48 GLU n 1 49 ILE n 1 50 ARG n 1 51 VAL n 1 52 ALA n 1 53 PHE n 1 54 THR n 1 55 ASN n 1 56 ASP n 1 57 ALA n 1 58 THR n 1 59 GLY n 1 60 ARG n 1 61 ASP n 1 62 VAL n 1 63 GLN n 1 64 VAL n 1 65 ASP n 1 66 TYR n 1 67 ILE n 1 68 VAL n 1 69 VAL n 1 70 ASN n 1 71 GLY n 1 72 GLN n 1 73 THR n 1 74 ARG n 1 75 GLN n 1 76 ALA n 1 77 GLU n 1 78 ASN n 1 79 GLN n 1 80 SER n 1 81 VAL n 1 82 ASN n 1 83 THR n 1 84 GLY n 1 85 VAL n 1 86 TRP n 1 87 ALA n 1 88 ASN n 1 89 ASN n 1 90 GLN n 1 91 CYS n 1 92 GLY n 1 93 GLY n 1 94 SER n 1 95 GLY n 1 96 ASN n 1 97 SER n 1 98 GLU n 1 99 TRP n 1 100 LEU n 1 101 HIS n 1 102 CYS n 1 103 ASN n 1 104 GLY n 1 105 TYR n 1 106 ILE n 1 107 SER n 1 108 PHE n 1 109 GLY n 1 110 ASN n 1 111 VAL n 1 112 SER n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'ESCHERICHIA COLI' _entity_src_nat.pdbx_ncbi_taxonomy_id 562 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details 'ENVIRONMENTAL ISOLATE' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D7GNB4_9BACT _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession D7GNB4 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2XFD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D7GNB4 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 111 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 111 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2XFD MET A 1 ? UNP D7GNB4 ? ? 'expression tag' 0 1 1 2XFD SER A 2 ? UNP D7GNB4 ? ? 'expression tag' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose ? 'C6 H12 O6' 180.156 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2XFD _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.1 _exptl_crystal.density_percent_sol 41 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '2.4 M SODIUM MALONATE, 10 MM CELLOTRIOSE, pH 8' # _diffrn.id 1 _diffrn.ambient_temp 287 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2009-04-20 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97980 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_wavelength 0.97980 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XFD _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.04 _reflns.d_resolution_high 1.19 _reflns.number_obs 30656 _reflns.number_all ? _reflns.percent_possible_obs 98.4 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 12.90 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 3.4 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.19 _reflns_shell.d_res_low 1.22 _reflns_shell.percent_possible_all 98.8 _reflns_shell.Rmerge_I_obs 0.18 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.70 _reflns_shell.pdbx_redundancy 3.4 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2XFD _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 30656 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.04 _refine.ls_d_res_high 1.19 _refine.ls_percent_reflns_obs 98.35 _refine.ls_R_factor_obs 0.11854 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.11699 _refine.ls_R_factor_R_free 0.14795 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1630 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.969 _refine.correlation_coeff_Fo_to_Fc_free 0.962 _refine.B_iso_mean 7.420 _refine.aniso_B[1][1] 0.14 _refine.aniso_B[2][2] -0.03 _refine.aniso_B[3][3] -0.11 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY.' _refine.pdbx_starting_model APO-VCBM60 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.031 _refine.pdbx_overall_ESU_R_Free 0.033 _refine.overall_SU_ML 0.016 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 0.760 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 816 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 31 _refine_hist.number_atoms_solvent 172 _refine_hist.number_atoms_total 1019 _refine_hist.d_res_high 1.19 _refine_hist.d_res_low 40.04 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.023 0.021 ? 870 'X-RAY DIFFRACTION' ? r_bond_other_d 0.000 0.020 ? 728 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.890 1.921 ? 1188 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.828 3.000 ? 1688 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.932 5.000 ? 114 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 36.039 25.476 ? 42 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 8.342 15.000 ? 125 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 9.114 15.000 ? 5 'X-RAY DIFFRACTION' ? r_chiral_restr 0.143 0.200 ? 143 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.020 ? 988 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.000 0.020 ? 170 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 2.107 1.500 ? 540 'X-RAY DIFFRACTION' ? r_mcbond_other 1.027 1.500 ? 236 'X-RAY DIFFRACTION' ? r_mcangle_it 2.925 2.000 ? 872 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.957 3.000 ? 308 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 5.251 4.500 ? 288 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 2.016 3.000 ? 1598 'X-RAY DIFFRACTION' ? r_sphericity_free 14.526 3.000 ? 174 'X-RAY DIFFRACTION' ? r_sphericity_bonded 5.408 3.000 ? 1582 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.190 _refine_ls_shell.d_res_low 1.221 _refine_ls_shell.number_reflns_R_work 2246 _refine_ls_shell.R_factor_R_work 0.143 _refine_ls_shell.percent_reflns_obs 98.83 _refine_ls_shell.R_factor_R_free 0.165 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 119 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2XFD _struct.title 'vCBM60 in complex with cellobiose' _struct.pdbx_descriptor 'CARBOHYDRATE BINDING MODULE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XFD _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 77 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 79 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 76 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 78 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 91 SG ? ? ? 1_555 A CYS 102 SG ? ? A CYS 90 A CYS 101 1_555 ? ? ? ? ? ? ? 2.077 ? ? covale1 covale both ? B BGC . O4 ? ? ? 1_555 B BGC . C1 ? ? B BGC 1 B BGC 2 1_555 ? ? ? ? ? ? ? 1.434 sing ? metalc1 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 55 A CA 1111 1_555 ? ? ? ? ? ? ? 2.429 ? ? metalc2 metalc ? ? A ARG 60 O ? ? ? 1_555 C CA . CA ? ? A ARG 59 A CA 1111 1_555 ? ? ? ? ? ? ? 2.367 ? ? metalc3 metalc ? ? A ASP 61 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 60 A CA 1111 1_555 ? ? ? ? ? ? ? 2.343 ? ? metalc4 metalc ? ? A ASP 65 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 64 A CA 1112 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc5 metalc ? ? A ASP 65 O ? ? ? 1_555 D CA . CA ? ? A ASP 64 A CA 1112 1_555 ? ? ? ? ? ? ? 2.474 ? ? metalc6 metalc ? ? A GLN 75 OE1 ? ? ? 1_555 D CA . CA ? ? A GLN 74 A CA 1112 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc7 metalc ? ? A GLU 77 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 76 A CA 1112 1_555 ? ? ? ? ? ? ? 2.457 ? ? metalc8 metalc ? ? A GLU 77 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 76 A CA 1112 1_555 ? ? ? ? ? ? ? 2.500 ? ? metalc9 metalc ? ? A GLU 98 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 97 A CA 1112 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc10 metalc ? ? A HIS 101 O ? ? ? 1_555 C CA . CA ? ? A HIS 100 A CA 1111 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc11 metalc ? ? C CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1111 A HOH 2100 1_555 ? ? ? ? ? ? ? 2.385 ? ? metalc12 metalc ? ? C CA . CA ? ? ? 1_555 B BGC . O2 ? ? A CA 1111 B BGC 2 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc13 metalc ? ? C CA . CA ? ? ? 1_555 B BGC . O3 ? ? A CA 1111 B BGC 2 1_555 ? ? ? ? ? ? ? 2.468 ? ? metalc14 metalc ? ? D CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 1112 A HOH 2110 1_555 ? ? ? ? ? ? ? 2.376 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 4 ? AC ? 2 ? AD ? 4 ? AE ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AC 1 2 ? anti-parallel AD 1 2 ? anti-parallel AD 2 3 ? anti-parallel AD 3 4 ? anti-parallel AE 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 37 ? SER A 42 ? GLN A 36 SER A 41 AA 2 SER A 4 ? GLY A 11 ? SER A 3 GLY A 10 AA 3 VAL A 62 ? VAL A 69 ? VAL A 61 VAL A 68 AA 4 GLN A 72 ? GLN A 75 ? GLN A 71 GLN A 74 AB 1 GLN A 37 ? SER A 42 ? GLN A 36 SER A 41 AB 2 SER A 4 ? GLY A 11 ? SER A 3 GLY A 10 AB 3 VAL A 62 ? VAL A 69 ? VAL A 61 VAL A 68 AB 4 TRP A 99 ? LEU A 100 ? TRP A 98 LEU A 99 AC 1 GLN A 72 ? GLN A 75 ? GLN A 71 GLN A 74 AC 2 VAL A 62 ? VAL A 69 ? VAL A 61 VAL A 68 AD 1 THR A 25 ? THR A 31 ? THR A 24 THR A 30 AD 2 SER A 17 ? VAL A 22 ? SER A 16 VAL A 21 AD 3 GLU A 48 ? PHE A 53 ? GLU A 47 PHE A 52 AD 4 GLY A 104 ? ASN A 110 ? GLY A 103 ASN A 109 AE 1 TRP A 86 ? ALA A 87 ? TRP A 85 ALA A 86 AE 2 GLN A 90 ? CYS A 91 ? GLN A 89 CYS A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ALA A 41 ? N ALA A 40 O ILE A 5 ? O ILE A 4 AA 2 3 N ARG A 10 ? N ARG A 9 O GLN A 63 ? O GLN A 62 AA 3 4 N VAL A 69 ? N VAL A 68 O GLN A 72 ? O GLN A 71 AB 1 2 N ALA A 41 ? N ALA A 40 O ILE A 5 ? O ILE A 4 AB 2 3 N ARG A 10 ? N ARG A 9 O GLN A 63 ? O GLN A 62 AB 3 4 N VAL A 62 ? N VAL A 61 O LEU A 100 ? O LEU A 99 AC 1 2 N ARG A 74 ? N ARG A 73 O ILE A 67 ? O ILE A 66 AD 1 2 N TRP A 30 ? N TRP A 29 O VAL A 18 ? O VAL A 17 AD 2 3 N GLN A 21 ? N GLN A 20 O ARG A 50 ? O ARG A 49 AD 3 4 N PHE A 53 ? N PHE A 52 O GLY A 104 ? O GLY A 103 AE 1 2 N ALA A 87 ? N ALA A 86 O GLN A 90 ? O GLN A 89 # _database_PDB_matrix.entry_id 2XFD _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XFD _atom_sites.fract_transf_matrix[1][1] 0.033772 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023815 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012488 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 SER 2 1 ? ? ? A . n A 1 3 ASN 3 2 2 ASN ASN A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 ILE 5 4 4 ILE ILE A . n A 1 6 THR 6 5 5 THR THR A . n A 1 7 VAL 7 6 6 VAL VAL A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 ALA 9 8 8 ALA ALA A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 GLY 11 10 10 GLY GLY A . n A 1 12 VAL 12 11 11 VAL VAL A . n A 1 13 ASN 13 12 12 ASN ASN A . n A 1 14 GLY 14 13 13 GLY GLY A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 SER 17 16 16 SER SER A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 SER 19 18 18 SER SER A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLN 21 20 20 GLN GLN A . n A 1 22 VAL 22 21 21 VAL VAL A . n A 1 23 GLY 23 22 22 GLY GLY A . n A 1 24 GLY 24 23 23 GLY GLY A . n A 1 25 THR 25 24 24 THR THR A . n A 1 26 THR 26 25 25 THR THR A . n A 1 27 VAL 27 26 26 VAL VAL A . n A 1 28 GLN 28 27 27 GLN GLN A . n A 1 29 THR 29 28 28 THR THR A . n A 1 30 TRP 30 29 29 TRP TRP A . n A 1 31 THR 31 30 30 THR THR A . n A 1 32 LEU 32 31 31 LEU LEU A . n A 1 33 THR 33 32 32 THR THR A . n A 1 34 THR 34 33 33 THR THR A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 MET 36 35 35 MET MET A . n A 1 37 GLN 37 36 36 GLN GLN A . n A 1 38 ASP 38 37 37 ASP ASP A . n A 1 39 TYR 39 38 38 TYR TYR A . n A 1 40 THR 40 39 39 THR THR A . n A 1 41 ALA 41 40 40 ALA ALA A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 THR 43 42 42 THR THR A . n A 1 44 SER 44 43 43 SER SER A . n A 1 45 LEU 45 44 44 LEU LEU A . n A 1 46 THR 46 45 45 THR THR A . n A 1 47 GLY 47 46 46 GLY GLY A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 ILE 49 48 48 ILE ILE A . n A 1 50 ARG 50 49 49 ARG ARG A . n A 1 51 VAL 51 50 50 VAL VAL A . n A 1 52 ALA 52 51 51 ALA ALA A . n A 1 53 PHE 53 52 52 PHE PHE A . n A 1 54 THR 54 53 53 THR THR A . n A 1 55 ASN 55 54 54 ASN ASN A . n A 1 56 ASP 56 55 55 ASP ASP A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 THR 58 57 57 THR THR A . n A 1 59 GLY 59 58 58 GLY GLY A . n A 1 60 ARG 60 59 59 ARG ARG A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 VAL 62 61 61 VAL VAL A . n A 1 63 GLN 63 62 62 GLN GLN A . n A 1 64 VAL 64 63 63 VAL VAL A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 TYR 66 65 65 TYR TYR A . n A 1 67 ILE 67 66 66 ILE ILE A . n A 1 68 VAL 68 67 67 VAL VAL A . n A 1 69 VAL 69 68 68 VAL VAL A . n A 1 70 ASN 70 69 69 ASN ASN A . n A 1 71 GLY 71 70 70 GLY GLY A . n A 1 72 GLN 72 71 71 GLN GLN A . n A 1 73 THR 73 72 72 THR THR A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 GLN 75 74 74 GLN GLN A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 ASN 78 77 77 ASN ASN A . n A 1 79 GLN 79 78 78 GLN GLN A . n A 1 80 SER 80 79 79 SER SER A . n A 1 81 VAL 81 80 80 VAL VAL A . n A 1 82 ASN 82 81 81 ASN ASN A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 GLY 84 83 83 GLY GLY A . n A 1 85 VAL 85 84 84 VAL VAL A . n A 1 86 TRP 86 85 85 TRP TRP A . n A 1 87 ALA 87 86 86 ALA ALA A . n A 1 88 ASN 88 87 87 ASN ASN A . n A 1 89 ASN 89 88 88 ASN ASN A . n A 1 90 GLN 90 89 89 GLN GLN A . n A 1 91 CYS 91 90 90 CYS CYS A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 GLY 93 92 92 GLY GLY A . n A 1 94 SER 94 93 93 SER SER A . n A 1 95 GLY 95 94 94 GLY GLY A . n A 1 96 ASN 96 95 95 ASN ASN A . n A 1 97 SER 97 96 96 SER SER A . n A 1 98 GLU 98 97 97 GLU GLU A . n A 1 99 TRP 99 98 98 TRP TRP A . n A 1 100 LEU 100 99 99 LEU LEU A . n A 1 101 HIS 101 100 100 HIS HIS A . n A 1 102 CYS 102 101 101 CYS CYS A . n A 1 103 ASN 103 102 102 ASN ASN A . n A 1 104 GLY 104 103 103 GLY GLY A . n A 1 105 TYR 105 104 104 TYR TYR A . n A 1 106 ILE 106 105 105 ILE ILE A . n A 1 107 SER 107 106 106 SER SER A . n A 1 108 PHE 108 107 107 PHE PHE A . n A 1 109 GLY 109 108 108 GLY GLY A . n A 1 110 ASN 110 109 109 ASN ASN A . n A 1 111 VAL 111 110 110 VAL VAL A . n A 1 112 SER 112 111 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 1111 1111 CA CA A . D 3 CA 1 1112 1112 CA CA A . E 4 GOL 1 1114 1114 GOL GOL A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900005 _pdbx_molecule_features.name beta-cellobiose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Metabolism _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900005 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 56 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? A ARG 60 ? A ARG 59 ? 1_555 78.3 ? 2 OD1 ? A ASP 56 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 OD2 ? A ASP 61 ? A ASP 60 ? 1_555 140.3 ? 3 O ? A ARG 60 ? A ARG 59 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 OD2 ? A ASP 61 ? A ASP 60 ? 1_555 74.0 ? 4 OD1 ? A ASP 56 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? A HIS 101 ? A HIS 100 ? 1_555 78.6 ? 5 O ? A ARG 60 ? A ARG 59 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? A HIS 101 ? A HIS 100 ? 1_555 115.0 ? 6 OD2 ? A ASP 61 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? A HIS 101 ? A HIS 100 ? 1_555 87.9 ? 7 OD1 ? A ASP 56 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? F HOH . ? A HOH 2100 ? 1_555 97.2 ? 8 O ? A ARG 60 ? A ARG 59 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? F HOH . ? A HOH 2100 ? 1_555 80.8 ? 9 OD2 ? A ASP 61 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? F HOH . ? A HOH 2100 ? 1_555 105.7 ? 10 O ? A HIS 101 ? A HIS 100 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O ? F HOH . ? A HOH 2100 ? 1_555 161.9 ? 11 OD1 ? A ASP 56 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O2 ? B BGC . ? B BGC 2 ? 1_555 139.0 ? 12 O ? A ARG 60 ? A ARG 59 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O2 ? B BGC . ? B BGC 2 ? 1_555 141.9 ? 13 OD2 ? A ASP 61 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O2 ? B BGC . ? B BGC 2 ? 1_555 75.7 ? 14 O ? A HIS 101 ? A HIS 100 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O2 ? B BGC . ? B BGC 2 ? 1_555 86.1 ? 15 O ? F HOH . ? A HOH 2100 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O2 ? B BGC . ? B BGC 2 ? 1_555 85.8 ? 16 OD1 ? A ASP 56 ? A ASP 55 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O3 ? B BGC . ? B BGC 2 ? 1_555 73.7 ? 17 O ? A ARG 60 ? A ARG 59 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O3 ? B BGC . ? B BGC 2 ? 1_555 144.1 ? 18 OD2 ? A ASP 61 ? A ASP 60 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O3 ? B BGC . ? B BGC 2 ? 1_555 141.1 ? 19 O ? A HIS 101 ? A HIS 100 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O3 ? B BGC . ? B BGC 2 ? 1_555 81.1 ? 20 O ? F HOH . ? A HOH 2100 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O3 ? B BGC . ? B BGC 2 ? 1_555 80.8 ? 21 O2 ? B BGC . ? B BGC 2 ? 1_555 CA ? C CA . ? A CA 1111 ? 1_555 O3 ? B BGC . ? B BGC 2 ? 1_555 66.4 ? 22 OD1 ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? A ASP 65 ? A ASP 64 ? 1_555 76.7 ? 23 OD1 ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE1 ? A GLN 75 ? A GLN 74 ? 1_555 95.7 ? 24 O ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE1 ? A GLN 75 ? A GLN 74 ? 1_555 80.1 ? 25 OD1 ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 77 ? A GLU 76 ? 1_555 154.2 ? 26 O ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 77 ? A GLU 76 ? 1_555 80.3 ? 27 OE1 ? A GLN 75 ? A GLN 74 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 77 ? A GLU 76 ? 1_555 91.8 ? 28 OD1 ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE1 ? A GLU 77 ? A GLU 76 ? 1_555 152.4 ? 29 O ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE1 ? A GLU 77 ? A GLU 76 ? 1_555 130.8 ? 30 OE1 ? A GLN 75 ? A GLN 74 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE1 ? A GLU 77 ? A GLU 76 ? 1_555 88.1 ? 31 OE2 ? A GLU 77 ? A GLU 76 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE1 ? A GLU 77 ? A GLU 76 ? 1_555 52.3 ? 32 OD1 ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 98 ? A GLU 97 ? 1_555 87.0 ? 33 O ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 98 ? A GLU 97 ? 1_555 97.3 ? 34 OE1 ? A GLN 75 ? A GLN 74 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 98 ? A GLU 97 ? 1_555 175.7 ? 35 OE2 ? A GLU 77 ? A GLU 76 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 98 ? A GLU 97 ? 1_555 84.4 ? 36 OE1 ? A GLU 77 ? A GLU 76 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 OE2 ? A GLU 98 ? A GLU 97 ? 1_555 91.1 ? 37 OD1 ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? F HOH . ? A HOH 2110 ? 1_555 75.1 ? 38 O ? A ASP 65 ? A ASP 64 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? F HOH . ? A HOH 2110 ? 1_555 148.4 ? 39 OE1 ? A GLN 75 ? A GLN 74 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? F HOH . ? A HOH 2110 ? 1_555 88.8 ? 40 OE2 ? A GLU 77 ? A GLU 76 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? F HOH . ? A HOH 2110 ? 1_555 129.9 ? 41 OE1 ? A GLU 77 ? A GLU 76 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? F HOH . ? A HOH 2110 ? 1_555 77.6 ? 42 OE2 ? A GLU 98 ? A GLU 97 ? 1_555 CA ? D CA . ? A CA 1112 ? 1_555 O ? F HOH . ? A HOH 2110 ? 1_555 95.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-16 2 'Structure model' 1 1 2012-08-15 3 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Non-polymer description' 3 2 'Structure model' Other 4 2 'Structure model' 'Structure summary' 5 2 'Structure model' 'Version format compliance' 6 3 'Structure model' 'Atomic model' 7 3 'Structure model' 'Data collection' 8 3 'Structure model' 'Derived calculations' 9 3 'Structure model' 'Non-polymer description' 10 3 'Structure model' Other 11 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' atom_site 2 3 'Structure model' atom_site_anisotrop 3 3 'Structure model' chem_comp 4 3 'Structure model' entity 5 3 'Structure model' entity_name_com 6 3 'Structure model' pdbx_branch_scheme 7 3 'Structure model' pdbx_chem_comp_identifier 8 3 'Structure model' pdbx_database_status 9 3 'Structure model' pdbx_entity_branch 10 3 'Structure model' pdbx_entity_branch_descriptor 11 3 'Structure model' pdbx_entity_branch_link 12 3 'Structure model' pdbx_entity_branch_list 13 3 'Structure model' pdbx_entity_nonpoly 14 3 'Structure model' pdbx_molecule_features 15 3 'Structure model' pdbx_nonpoly_scheme 16 3 'Structure model' pdbx_struct_conn_angle 17 3 'Structure model' struct_asym 18 3 'Structure model' struct_conn 19 3 'Structure model' struct_conn_type 20 3 'Structure model' struct_site 21 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_atom_site.B_iso_or_equiv' 2 3 'Structure model' '_atom_site.Cartn_x' 3 3 'Structure model' '_atom_site.Cartn_y' 4 3 'Structure model' '_atom_site.Cartn_z' 5 3 'Structure model' '_atom_site.auth_asym_id' 6 3 'Structure model' '_atom_site.auth_atom_id' 7 3 'Structure model' '_atom_site.auth_comp_id' 8 3 'Structure model' '_atom_site.auth_seq_id' 9 3 'Structure model' '_atom_site.label_asym_id' 10 3 'Structure model' '_atom_site.label_atom_id' 11 3 'Structure model' '_atom_site.label_comp_id' 12 3 'Structure model' '_atom_site.label_entity_id' 13 3 'Structure model' '_atom_site.occupancy' 14 3 'Structure model' '_atom_site.type_symbol' 15 3 'Structure model' '_atom_site_anisotrop.U[1][1]' 16 3 'Structure model' '_atom_site_anisotrop.U[1][2]' 17 3 'Structure model' '_atom_site_anisotrop.U[1][3]' 18 3 'Structure model' '_atom_site_anisotrop.U[2][2]' 19 3 'Structure model' '_atom_site_anisotrop.U[2][3]' 20 3 'Structure model' '_atom_site_anisotrop.U[3][3]' 21 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_asym_id' 22 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_atom_id' 23 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_comp_id' 24 3 'Structure model' '_atom_site_anisotrop.pdbx_auth_seq_id' 25 3 'Structure model' '_atom_site_anisotrop.pdbx_label_asym_id' 26 3 'Structure model' '_atom_site_anisotrop.pdbx_label_atom_id' 27 3 'Structure model' '_atom_site_anisotrop.pdbx_label_comp_id' 28 3 'Structure model' '_atom_site_anisotrop.type_symbol' 29 3 'Structure model' '_chem_comp.formula' 30 3 'Structure model' '_chem_comp.formula_weight' 31 3 'Structure model' '_chem_comp.id' 32 3 'Structure model' '_chem_comp.name' 33 3 'Structure model' '_chem_comp.type' 34 3 'Structure model' '_entity.formula_weight' 35 3 'Structure model' '_entity.pdbx_description' 36 3 'Structure model' '_entity.pdbx_number_of_molecules' 37 3 'Structure model' '_entity.src_method' 38 3 'Structure model' '_entity.type' 39 3 'Structure model' '_pdbx_database_status.status_code_sf' 40 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 41 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 42 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 43 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 44 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 45 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 46 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 47 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 48 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 49 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 50 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 51 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 52 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 53 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 54 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 55 3 'Structure model' '_pdbx_struct_conn_angle.value' 56 3 'Structure model' '_struct_asym.entity_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0066 ? 1 iMOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 MOLREP phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2021 ? ? O A HOH 2022 ? ? 2.00 2 1 NE2 A GLN 27 ? ? O A HOH 2050 ? ? 2.04 3 1 O A HOH 2030 ? ? O A HOH 2032 ? ? 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 2047 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 2061 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 1_655 _pdbx_validate_symm_contact.dist 1.86 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A VAL 11 ? ? CG2 A VAL 11 ? ? 1.294 1.524 -0.230 0.021 N 2 1 CZ A TYR 104 ? ? CE2 A TYR 104 ? ? 1.299 1.381 -0.082 0.013 N # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2073 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 5.86 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A SER 1 ? A SER 2 3 1 Y 1 A SER 111 ? A SER 112 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 A CBI 1113 n B 2 BGC 2 B BGC 2 A CBI 1113 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpb1-4DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Glcp]{[(4+1)][b-D-Glcp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 BGC _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 BGC _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 BGC 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 GLYCEROL GOL 5 water HOH #