data_2XK0 # _entry.id 2XK0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2XK0 pdb_00002xk0 10.2210/pdb2xk0/pdb PDBE EBI-44400 ? ? WWPDB D_1290044400 ? ? BMRB 17050 ? ? # _pdbx_database_related.db_id 17050 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XK0 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-07-07 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Friberg, A.' 1 'Oddone, A.' 2 'Klymenko, T.' 3 'Mueller, J.' 4 'Sattler, M.' 5 # _citation.id primary _citation.title 'Structure of an Atypical Tudor Domain in the Drosophila Polycomblike Protein' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 19 _citation.page_first 1906 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20669242 _citation.pdbx_database_id_DOI 10.1002/PRO.476 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Friberg, A.' 1 ? primary 'Oddone, A.' 2 ? primary 'Klymenko, T.' 3 ? primary 'Mueller, J.' 4 ? primary 'Sattler, M.' 5 ? # _cell.entry_id 2XK0 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XK0 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'POLYCOMB PROTEIN PCL' _entity.formula_weight 7588.437 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'TUDOR DOMAIN, RESIDUES 339-404' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'POLYCOMBLIKE PROTEIN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS _entity_poly.pdbx_seq_one_letter_code_can GAMAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 PRO n 1 6 PRO n 1 7 VAL n 1 8 ALA n 1 9 ALA n 1 10 PRO n 1 11 SER n 1 12 PRO n 1 13 ALA n 1 14 VAL n 1 15 THR n 1 16 TYR n 1 17 ALA n 1 18 LEU n 1 19 GLN n 1 20 GLU n 1 21 ASP n 1 22 VAL n 1 23 PHE n 1 24 ILE n 1 25 LYS n 1 26 CYS n 1 27 ASN n 1 28 ASP n 1 29 GLY n 1 30 ARG n 1 31 PHE n 1 32 TYR n 1 33 LEU n 1 34 GLY n 1 35 THR n 1 36 ILE n 1 37 ILE n 1 38 ASP n 1 39 GLN n 1 40 THR n 1 41 SER n 1 42 ASP n 1 43 GLN n 1 44 TYR n 1 45 LEU n 1 46 ILE n 1 47 ARG n 1 48 PHE n 1 49 ASP n 1 50 ASP n 1 51 GLN n 1 52 SER n 1 53 GLU n 1 54 GLN n 1 55 TRP n 1 56 CYS n 1 57 GLU n 1 58 PRO n 1 59 ASP n 1 60 LYS n 1 61 LEU n 1 62 ARG n 1 63 LYS n 1 64 LEU n 1 65 GLY n 1 66 GLY n 1 67 GLY n 1 68 SER n 1 69 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'FRUIT FLY' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'DROSOPHILA MELANOGASTER' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) PLYSS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET-24D _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCL_DROME _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q24459 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2XK0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q24459 _struct_ref_seq.db_align_beg 339 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 404 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 75 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2XK0 GLY A 1 ? UNP Q24459 ? ? 'expression tag' 7 1 1 2XK0 ALA A 2 ? UNP Q24459 ? ? 'expression tag' 8 2 1 2XK0 MET A 3 ? UNP Q24459 ? ? 'expression tag' 9 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HNCA 1 2 1 HNCACB 1 3 1 'CBCA(CO)NH' 1 4 1 '(H)CC(CO)NH-TOCSY' 1 5 1 'H(CC)(CO) NH-TOCSY' 1 6 1 'H(C)CH-TOCSY' 1 7 1 '(HB)CB(CG' 1 8 1 'CD)HD' 1 9 1 '(HB)CB(CG' 1 10 1 CD 1 11 1 'CE)HE' 1 12 1 '1H-15N HSQC- NOESY' 1 13 1 '1H-13C HMQC-NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.5 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER/10% D2O' _pdbx_nmr_sample_details.solvent_system ? _pdbx_nmr_sample_details.label ? _pdbx_nmr_sample_details.type ? _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 500 ? 2 ? Bruker 600 ? 3 ? Bruker 750 ? 4 ? Bruker 900 ? # _pdbx_nmr_refine.entry_id 2XK0 _pdbx_nmr_refine.method CYANA _pdbx_nmr_refine.details 'ADDITIONALLY WATER-REFINED' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2XK0 _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 2XK0 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ENERGY # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS ? 'BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ, RICE,SIMONSON,WARREN' 1 'structure solution' NMRView ? ? 2 # _exptl.entry_id 2XK0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2XK0 _struct.title 'Solution structure of the Tudor domain from Drosophila Polycomblike (Pcl)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XK0 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'TRANSCRIPTION, AROMATIC CAGE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLU A 53 ? CYS A 56 ? GLU A 59 CYS A 62 AA 2 TYR A 44 ? PHE A 48 ? TYR A 50 PHE A 54 AA 3 PHE A 31 ? GLN A 39 ? PHE A 37 GLN A 45 AA 4 ASP A 21 ? LYS A 25 ? ASP A 27 LYS A 31 AA 5 LEU A 61 ? ARG A 62 ? LEU A 67 ARG A 68 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N CYS A 56 ? N CYS A 62 O TYR A 44 ? O TYR A 50 AA 2 3 N ARG A 47 ? N ARG A 53 O THR A 35 ? O THR A 41 AA 3 4 N GLY A 34 ? N GLY A 40 O VAL A 22 ? O VAL A 28 AA 4 5 N PHE A 23 ? N PHE A 29 O ARG A 62 ? O ARG A 68 # _database_PDB_matrix.entry_id 2XK0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XK0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 7 7 GLY GLY A . n A 1 2 ALA 2 8 8 ALA ALA A . n A 1 3 MET 3 9 9 MET MET A . n A 1 4 ALA 4 10 10 ALA ALA A . n A 1 5 PRO 5 11 11 PRO PRO A . n A 1 6 PRO 6 12 12 PRO PRO A . n A 1 7 VAL 7 13 13 VAL VAL A . n A 1 8 ALA 8 14 14 ALA ALA A . n A 1 9 ALA 9 15 15 ALA ALA A . n A 1 10 PRO 10 16 16 PRO PRO A . n A 1 11 SER 11 17 17 SER SER A . n A 1 12 PRO 12 18 18 PRO PRO A . n A 1 13 ALA 13 19 19 ALA ALA A . n A 1 14 VAL 14 20 20 VAL VAL A . n A 1 15 THR 15 21 21 THR THR A . n A 1 16 TYR 16 22 22 TYR TYR A . n A 1 17 ALA 17 23 23 ALA ALA A . n A 1 18 LEU 18 24 24 LEU LEU A . n A 1 19 GLN 19 25 25 GLN GLN A . n A 1 20 GLU 20 26 26 GLU GLU A . n A 1 21 ASP 21 27 27 ASP ASP A . n A 1 22 VAL 22 28 28 VAL VAL A . n A 1 23 PHE 23 29 29 PHE PHE A . n A 1 24 ILE 24 30 30 ILE ILE A . n A 1 25 LYS 25 31 31 LYS LYS A . n A 1 26 CYS 26 32 32 CYS CYS A . n A 1 27 ASN 27 33 33 ASN ASN A . n A 1 28 ASP 28 34 34 ASP ASP A . n A 1 29 GLY 29 35 35 GLY GLY A . n A 1 30 ARG 30 36 36 ARG ARG A . n A 1 31 PHE 31 37 37 PHE PHE A . n A 1 32 TYR 32 38 38 TYR TYR A . n A 1 33 LEU 33 39 39 LEU LEU A . n A 1 34 GLY 34 40 40 GLY GLY A . n A 1 35 THR 35 41 41 THR THR A . n A 1 36 ILE 36 42 42 ILE ILE A . n A 1 37 ILE 37 43 43 ILE ILE A . n A 1 38 ASP 38 44 44 ASP ASP A . n A 1 39 GLN 39 45 45 GLN GLN A . n A 1 40 THR 40 46 46 THR THR A . n A 1 41 SER 41 47 47 SER SER A . n A 1 42 ASP 42 48 48 ASP ASP A . n A 1 43 GLN 43 49 49 GLN GLN A . n A 1 44 TYR 44 50 50 TYR TYR A . n A 1 45 LEU 45 51 51 LEU LEU A . n A 1 46 ILE 46 52 52 ILE ILE A . n A 1 47 ARG 47 53 53 ARG ARG A . n A 1 48 PHE 48 54 54 PHE PHE A . n A 1 49 ASP 49 55 55 ASP ASP A . n A 1 50 ASP 50 56 56 ASP ASP A . n A 1 51 GLN 51 57 57 GLN GLN A . n A 1 52 SER 52 58 58 SER SER A . n A 1 53 GLU 53 59 59 GLU GLU A . n A 1 54 GLN 54 60 60 GLN GLN A . n A 1 55 TRP 55 61 61 TRP TRP A . n A 1 56 CYS 56 62 62 CYS CYS A . n A 1 57 GLU 57 63 63 GLU GLU A . n A 1 58 PRO 58 64 64 PRO PRO A . n A 1 59 ASP 59 65 65 ASP ASP A . n A 1 60 LYS 60 66 66 LYS LYS A . n A 1 61 LEU 61 67 67 LEU LEU A . n A 1 62 ARG 62 68 68 ARG ARG A . n A 1 63 LYS 63 69 69 LYS LYS A . n A 1 64 LEU 64 70 70 LEU LEU A . n A 1 65 GLY 65 71 71 GLY GLY A . n A 1 66 GLY 66 72 72 GLY GLY A . n A 1 67 GLY 67 73 73 GLY GLY A . n A 1 68 SER 68 74 74 SER SER A . n A 1 69 SER 69 75 75 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-11 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-01-15 5 'Structure model' 1 4 2021-06-23 6 'Structure model' 1 5 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 5 'Structure model' 'Data collection' 6 6 'Structure model' 'Database references' 7 6 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_software 3 5 'Structure model' pdbx_nmr_spectrometer 4 6 'Structure model' database_2 5 6 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_database_status.status_code_mr' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 6 'Structure model' '_database_2.pdbx_DOI' 5 6 'Structure model' '_database_2.pdbx_database_accession' 6 6 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 2XK0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THE FIRST THREE RESIDUES (GAM) IS A CLONING ARTIFACT.' _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H2 A GLY 7 ? ? OE1 A GLU 63 ? ? 1.59 2 4 HZ3 A LYS 69 ? ? OXT A SER 75 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 9 ? ? 74.40 -44.26 2 1 PRO A 16 ? ? -64.20 -168.97 3 2 ALA A 8 ? ? -178.81 138.28 4 2 ALA A 19 ? ? -174.39 134.02 5 2 THR A 46 ? ? -114.69 -168.61 6 2 SER A 74 ? ? -128.91 -64.33 7 3 ALA A 8 ? ? 63.15 97.18 8 3 VAL A 13 ? ? 69.47 -68.28 9 3 PRO A 16 ? ? -73.63 -157.50 10 3 ALA A 19 ? ? 57.67 79.35 11 4 ALA A 8 ? ? -161.01 -38.68 12 4 ALA A 19 ? ? 55.20 79.61 13 4 THR A 46 ? ? -124.59 -166.47 14 5 MET A 9 ? ? 73.65 152.65 15 5 VAL A 13 ? ? 72.58 156.45 16 5 ALA A 14 ? ? 75.50 -171.65 17 6 MET A 9 ? ? 74.93 -53.69 18 6 ALA A 14 ? ? 174.49 32.92 19 6 PRO A 16 ? ? -77.13 -142.64 20 7 MET A 9 ? ? 166.92 103.70 21 7 PRO A 12 ? ? -71.71 44.81 22 7 ALA A 15 ? ? -130.85 -54.60 23 7 ALA A 19 ? ? 173.88 140.68 24 8 ALA A 8 ? ? 45.90 85.13 25 8 ALA A 19 ? ? 58.35 83.86 26 8 THR A 46 ? ? -115.84 -165.57 27 9 ALA A 8 ? ? 63.45 90.23 28 9 PRO A 16 ? ? -55.92 -179.42 29 9 SER A 74 ? ? -164.43 44.81 30 10 ALA A 8 ? ? 65.77 151.28 31 10 ALA A 15 ? ? -150.00 -53.16 #