data_2XKM # _entry.id 2XKM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.341 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2XKM PDBE EBI-44421 WWPDB D_1290044421 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1PJF unspecified 'SOLID STATE NMR STRUCTURE OF THE PF1 MAJOR COAT PROTEIN INMAGNETICALLY ALIGNED BACTERIOPHAGE' PDB 1IFN unspecified 'TWO FORMS OF PF1 INOVIRUS: X-RAY DIFFRACTION STUDIES ON ASTRUCTURAL PHASE TRANSITION AND A CALCULATED LIBRATION' PDB 3IFM unspecified . PDB 1QL1 unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY' PDB 1PFI unspecified . PDB 1IFM unspecified . PDB 1QL2 unspecified 'INOVIRUS (FILAMENTOUS BACTERIOPHAGE) STRAIN PF1 MAJOR COAT PROTEIN ASSEMBLY' PDB 2IFM unspecified . PDB 4IFM unspecified . PDB 2IFN unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XKM _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-07-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Straus, S.K.' 1 'P Scott, W.R.' 2 'Schwieters, C.D.' 3 'Marvin, D.A.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Consensus Structure of Pf1 Filamentous Bacteriophage from X-Ray Fibre Diffraction and Solid-State NMR.' Eur.Biophys.J. 40 221 ? 2011 EBJOE8 GW 0175-7571 0997 ? 21082179 10.1007/S00249-010-0640-9 1 'Structural Basis of the Temperature Transition of Pf1 Bacteriophage.' 'Protein Sci.' 14 1064 ? 2005 PRCIEI US 0961-8368 0795 ? 15741342 10.1110/PS.041220305 2 ;Pf1 Filamentous Bacteriophage: Refinement of a Molecular Model by Simulated Annealing Using 3.3 A Resolution X-Ray Fibre Diffraction Data. ; 'Acta Crystallogr.,Sect.D' 51 792 ? 1995 ABCRE6 DK 0907-4449 0766 ? 15299811 10.1107/S0907444995003027 3 'The Hand of the Filamentous Bacteriophage Helix.' Eur.Biophys.J. 37 1077 ? 2008 EBJOE8 GW 0175-7571 0997 ? 18421454 10.1007/S00249-008-0327-7 4 'Dynamics of Telescoping Inovirus: A Mechanism for Assembly at Membrane Adhesions.' Int.J.Biol.Macromol. 11 159 ? 1989 IJBMDR UK 0141-8130 0708 ? 2489076 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Straus, S.K.' 1 ? primary 'Scott, W.R.' 2 ? primary 'Schwieters, C.D.' 3 ? primary 'Marvin, D.A.' 4 ? 1 'Thiriot, D.S.' 5 ? 1 'Nevzorov, A.A.' 6 ? 1 'Opella, S.J.' 7 ? 2 'Gonzalez, A.' 8 ? 2 'Nave, C.' 9 ? 2 'Marvin, D.A.' 10 ? 3 'Straus, S.K.' 11 ? 3 'Scott, W.R.P.' 12 ? 3 'Marvin, D.A.' 13 ? 4 'Marvin, D.A.' 14 ? # _cell.entry_id 2XKM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XKM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'CAPSID PROTEIN G8P' _entity.formula_weight 4612.393 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RESIDUES 37-82' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAJOR COAT PROTEIN, GENE 8 PROTEIN, G8P, COAT PROTEIN B, PF1 PHAGE COAT PROTEIN GENE 8' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _entity_poly.pdbx_seq_one_letter_code_can GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 ILE n 1 4 ASP n 1 5 THR n 1 6 SER n 1 7 ALA n 1 8 VAL n 1 9 GLU n 1 10 SER n 1 11 ALA n 1 12 ILE n 1 13 THR n 1 14 ASP n 1 15 GLY n 1 16 GLN n 1 17 GLY n 1 18 ASP n 1 19 MET n 1 20 LYS n 1 21 ALA n 1 22 ILE n 1 23 GLY n 1 24 GLY n 1 25 TYR n 1 26 ILE n 1 27 VAL n 1 28 GLY n 1 29 ALA n 1 30 LEU n 1 31 VAL n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 VAL n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 ILE n 1 40 TYR n 1 41 SER n 1 42 MET n 1 43 LEU n 1 44 ARG n 1 45 LYS n 1 46 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'PSEUDOMONAS PHAGE PF1' _entity_src_nat.pdbx_ncbi_taxonomy_id 10871 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc 25102-B1 _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAPSD_BPPF1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P03621 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2XKM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03621 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 2XKM _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _exptl.entry_id _exptl.method _exptl.crystals_number 2XKM 'FIBER DIFFRACTION' ? 2XKM 'SOLID-STATE NMR' ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description NONE # _diffrn.id 1 _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XKM _reflns.observed_criterion_sigma_I 0.8 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 12.00 _reflns.d_resolution_high 2.60 _reflns.number_obs 3548 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? # _refine.pdbx_refine_id 'FIBER DIFFRACTION' _refine.entry_id 2XKM _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 3.30 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 4IFM' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'FIBER DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 322 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 322 _refine_hist.d_res_high 3.30 _refine_hist.d_res_low . # _struct.entry_id 2XKM _struct.title 'Consensus structure of Pf1 filamentous bacteriophage from X-ray fibre diffraction and solid-state NMR' _struct.pdbx_descriptor 'CAPSID PROTEIN G8P' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XKM _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'VIRAL PROTEIN, CAPSID PROTEIN, TRANSMEMBRANE, VIRION, VIRUS COAT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ;THE ASSEMBLY REPRESENTED IN THIS ENTRY HAS REGULAR HELICAL SYMMETRY WITH THE FOLLOWING PARAMETERS: ROTATION PER SUBUNIT (TWIST) = 65.915 DEGREES RISE PER SUBUNIT (HEIGHT) = 3.05 ANGSTROMS COORDINATES ARE GIVEN FOR A SINGLE ASYMMETRIC UNIT OF THE COAT PROTEIN ASSEMBLY. THE COMPLETE PROTEIN ASSEMBLY CONTAINS SEVERAL THOUSAND ASYMMETRIC UNITS; THE EXACT NUMBER DEPENDS ON THE LENGTH OF THE DNA. THE PROTEIN ASSEMBLY FORMS A CYLINDRICAL SHELL SURROUNDING A DNA CORE. ; # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 5 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 46 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 5 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 46 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 42 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2XKM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XKM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'representative helical assembly' ? helical 35 2 'helical asymmetric unit' ? monomeric 1 3 'helical asymmetric unit, std helical frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-35)' A 2 18 A 3 H A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] H 'transform to helical frame' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'helical symmetry operation' ? ? 0.75978219 0.65017769 0.00000000 0.00000 -0.65017769 0.75978219 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -51.85000 2 'helical symmetry operation' ? ? 0.90363453 -0.42830438 0.00000000 0.00000 0.42830438 0.90363453 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -48.80000 3 'helical symmetry operation' ? ? -0.02225111 -0.99975241 0.00000000 0.00000 0.99975241 -0.02225111 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -45.75000 4 'helical symmetry operation' ? ? -0.92179550 -0.38767648 0.00000000 0.00000 0.38767648 -0.92179550 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -42.70000 5 'helical symmetry operation' ? ? -0.73010265 0.68333749 0.00000000 0.00000 -0.68333749 -0.73010265 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -39.65000 6 'helical symmetry operation' ? ? 0.32589818 0.94540487 0.00000000 0.00000 -0.94540487 0.32589818 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -36.60000 7 'helical symmetry operation' ? ? 0.99609518 0.08828583 0.00000000 0.00000 -0.08828583 0.99609518 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -33.55000 8 'helical symmetry operation' ? ? 0.48709771 -0.87334748 0.00000000 0.00000 0.87334748 0.48709771 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -30.50000 9 'helical symmetry operation' ? ? -0.59853435 -0.80109714 0.00000000 0.00000 0.80109714 -0.59853435 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -27.45000 10 'helical symmetry operation' ? ? -0.97561123 0.21950567 0.00000000 0.00000 -0.21950567 -0.97561123 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -24.40000 11 'helical symmetry operation' ? ? -0.19774288 0.98025392 0.00000000 0.00000 -0.98025392 -0.19774288 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -21.35000 12 'helical symmetry operation' ? ? 0.81421686 0.58056086 0.00000000 0.00000 -0.58056086 0.81421686 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -18.30000 13 'helical symmetry operation' ? ? 0.86229279 -0.50641006 0.00000000 0.00000 0.50641006 0.86229279 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -15.25000 14 'helical symmetry operation' ? ? -0.11042820 -0.99388410 0.00000000 0.00000 0.99388410 -0.11042820 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -12.20000 15 'helical symmetry operation' ? ? -0.95242240 -0.30478119 0.00000000 0.00000 0.30478119 -0.95242240 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -9.15000 16 'helical symmetry operation' ? ? -0.66692271 0.74512690 0.00000000 0.00000 -0.74512690 -0.66692271 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -6.10000 17 'helical symmetry operation' ? ? 0.40809147 0.91294105 0.00000000 0.00000 -0.91294105 0.40809147 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -3.05000 18 'helical symmetry operation' ? ? 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 19 'helical symmetry operation' ? ? 0.40809147 -0.91294105 0.00000000 0.00000 0.91294105 0.40809147 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 3.05000 20 'helical symmetry operation' ? ? -0.66692271 -0.74512690 0.00000000 0.00000 0.74512690 -0.66692271 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 6.10000 21 'helical symmetry operation' ? ? -0.95242240 0.30478119 0.00000000 0.00000 -0.30478119 -0.95242240 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 9.15000 22 'helical symmetry operation' ? ? -0.11042820 0.99388410 0.00000000 0.00000 -0.99388410 -0.11042820 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 12.20000 23 'helical symmetry operation' ? ? 0.86229279 0.50641006 0.00000000 0.00000 -0.50641006 0.86229279 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 15.25000 24 'helical symmetry operation' ? ? 0.81421686 -0.58056086 0.00000000 0.00000 0.58056086 0.81421686 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 18.30000 25 'helical symmetry operation' ? ? -0.19774288 -0.98025392 0.00000000 0.00000 0.98025392 -0.19774288 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 21.35000 26 'helical symmetry operation' ? ? -0.97561123 -0.21950567 0.00000000 0.00000 0.21950567 -0.97561123 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 24.40000 27 'helical symmetry operation' ? ? -0.59853435 0.80109714 0.00000000 0.00000 -0.80109714 -0.59853435 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 27.45000 28 'helical symmetry operation' ? ? 0.48709771 0.87334748 0.00000000 0.00000 -0.87334748 0.48709771 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 30.50000 29 'helical symmetry operation' ? ? 0.99609518 -0.08828583 0.00000000 0.00000 0.08828583 0.99609518 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 33.55000 30 'helical symmetry operation' ? ? 0.32589818 -0.94540487 0.00000000 0.00000 0.94540487 0.32589818 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 36.60000 31 'helical symmetry operation' ? ? -0.73010265 -0.68333749 0.00000000 0.00000 0.68333749 -0.73010265 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 39.65000 32 'helical symmetry operation' ? ? -0.92179550 0.38767648 0.00000000 0.00000 -0.38767648 -0.92179550 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 42.70000 33 'helical symmetry operation' ? ? -0.02225111 0.99975241 0.00000000 0.00000 -0.99975241 -0.02225111 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 45.75000 34 'helical symmetry operation' ? ? 0.90363453 0.42830438 0.00000000 0.00000 -0.42830438 0.90363453 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 48.80000 35 'helical symmetry operation' ? ? 0.75978219 -0.65017769 0.00000000 0.00000 0.65017769 0.75978219 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 51.85000 # _pdbx_helical_symmetry.entry_id 2XKM _pdbx_helical_symmetry.number_of_operations 35 _pdbx_helical_symmetry.rotation_per_n_subunits 65.915000 _pdbx_helical_symmetry.rise_per_n_subunits 3.050000 _pdbx_helical_symmetry.n_subunits_divisor 1 _pdbx_helical_symmetry.dyad_axis no _pdbx_helical_symmetry.circular_symmetry 1 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-24 2 'Structure model' 1 1 2013-11-27 3 'Structure model' 1 2 2019-09-18 4 'Structure model' 1 3 2021-04-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 2 'Structure model' 'Version format compliance' 5 3 'Structure model' 'Data collection' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' reflns 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' reflns # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_reflns.pdbx_Rmerge_I_obs' 2 3 'Structure model' '_reflns.percent_possible_obs' 3 4 'Structure model' '_pdbx_database_status.status_code_mr' 4 4 'Structure model' '_pdbx_database_status.status_code_sf' 5 4 'Structure model' '_reflns.pdbx_redundancy' # _software.classification phasing _software.name XPLOR-NIH _software.version . _software.citation_id ? _software.pdbx_ordinal 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? 170.28 146.94 2 1 THR A 5 ? ? -106.27 40.90 #