data_2XL7 # _entry.id 2XL7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2XL7 pdb_00002xl7 10.2210/pdb2xl7/pdb PDBE EBI-44678 ? ? WWPDB D_1290044678 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2XLG unspecified 'STRUCTURE AND METAL-LOADING OF A SOLUBLE PERIPLASM CUPRO-PROTEIN: CU-CUCA-OPEN' PDB 2XLF unspecified 'STRUCTURE AND METAL-LOADING OF A SOLUBLE PERIPLASM CUPRO-PROTEIN: APO-CUCA-CLOSED (SEMET)' PDB 2XL9 unspecified 'STRUCTURE AND METAL-LOADING OF A SOLUBLE PERIPLASM CUPRO-PROTEIN: ZN-CUCA-CLOSED (SEMET)' PDB 2XLA unspecified 'STRUCTURE AND METAL-LOADING OF A SOLUBLE PERIPLASM CUPRO-PROTEIN: CU-CUCA-CLOSED' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XL7 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-07-19 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Waldron, K.J.' 1 'Firbank, S.J.' 2 'Dainty, S.J.' 3 'Perez-Rama, M.' 4 'Tottey, S.' 5 'Robinson, N.J.' 6 # _citation.id primary _citation.title 'Structure and Metal Loading of a Soluble Periplasm Cuproprotein.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 285 _citation.page_first 32504 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20702411 _citation.pdbx_database_id_DOI 10.1074/JBC.M110.153080 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Waldron, K.J.' 1 ? primary 'Firbank, S.J.' 2 ? primary 'Dainty, S.J.' 3 ? primary 'Perez-Rama, M.' 4 ? primary 'Tottey, S.' 5 ? primary 'Robinson, N.J.' 6 ? # _cell.entry_id 2XL7 _cell.length_a 88.483 _cell.length_b 88.483 _cell.length_c 192.419 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XL7 _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SLL1785 PROTEIN' 27305.408 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 2 ? ? ? ? 3 non-polymer syn UREA 60.055 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 197 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name CUCA # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)AETEIHTFDDIP(MSE)PKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGP(MSE)PHIHYFINEWF WTPEGGIELFHSTKQYPN(MSE)DELPVVGGAGRGDLYSIQSEPKQLIYSPNHY(MSE)HGFVNPTDKTLPIVFVW (MSE)RNEVAPDFPYHDGG(MSE)REYFQAVGPRITDLNNLPELTNAQRAAFASEAPKYGINQSSYF(MSE)EYVNTISD KLPAQIAKLKNDKDLER(MSE)VEVIEAFNRGDKSVTCS ; _entity_poly.pdbx_seq_one_letter_code_can ;MAETEIHTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHS TKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVG PRITDLNNLPELTNAQRAAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ALA n 1 3 GLU n 1 4 THR n 1 5 GLU n 1 6 ILE n 1 7 HIS n 1 8 THR n 1 9 PHE n 1 10 ASP n 1 11 ASP n 1 12 ILE n 1 13 PRO n 1 14 MSE n 1 15 PRO n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 ASP n 1 20 PRO n 1 21 LEU n 1 22 LEU n 1 23 ILE n 1 24 TYR n 1 25 THR n 1 26 PRO n 1 27 ALA n 1 28 ASN n 1 29 GLU n 1 30 ILE n 1 31 PHE n 1 32 ASP n 1 33 ILE n 1 34 ALA n 1 35 SER n 1 36 CYS n 1 37 SER n 1 38 ALA n 1 39 LYS n 1 40 ASP n 1 41 ILE n 1 42 GLY n 1 43 PHE n 1 44 ALA n 1 45 ILE n 1 46 ALA n 1 47 HIS n 1 48 ALA n 1 49 GLN n 1 50 ILE n 1 51 PRO n 1 52 PRO n 1 53 GLY n 1 54 GLY n 1 55 GLY n 1 56 PRO n 1 57 MSE n 1 58 PRO n 1 59 HIS n 1 60 ILE n 1 61 HIS n 1 62 TYR n 1 63 PHE n 1 64 ILE n 1 65 ASN n 1 66 GLU n 1 67 TRP n 1 68 PHE n 1 69 TRP n 1 70 THR n 1 71 PRO n 1 72 GLU n 1 73 GLY n 1 74 GLY n 1 75 ILE n 1 76 GLU n 1 77 LEU n 1 78 PHE n 1 79 HIS n 1 80 SER n 1 81 THR n 1 82 LYS n 1 83 GLN n 1 84 TYR n 1 85 PRO n 1 86 ASN n 1 87 MSE n 1 88 ASP n 1 89 GLU n 1 90 LEU n 1 91 PRO n 1 92 VAL n 1 93 VAL n 1 94 GLY n 1 95 GLY n 1 96 ALA n 1 97 GLY n 1 98 ARG n 1 99 GLY n 1 100 ASP n 1 101 LEU n 1 102 TYR n 1 103 SER n 1 104 ILE n 1 105 GLN n 1 106 SER n 1 107 GLU n 1 108 PRO n 1 109 LYS n 1 110 GLN n 1 111 LEU n 1 112 ILE n 1 113 TYR n 1 114 SER n 1 115 PRO n 1 116 ASN n 1 117 HIS n 1 118 TYR n 1 119 MSE n 1 120 HIS n 1 121 GLY n 1 122 PHE n 1 123 VAL n 1 124 ASN n 1 125 PRO n 1 126 THR n 1 127 ASP n 1 128 LYS n 1 129 THR n 1 130 LEU n 1 131 PRO n 1 132 ILE n 1 133 VAL n 1 134 PHE n 1 135 VAL n 1 136 TRP n 1 137 MSE n 1 138 ARG n 1 139 ASN n 1 140 GLU n 1 141 VAL n 1 142 ALA n 1 143 PRO n 1 144 ASP n 1 145 PHE n 1 146 PRO n 1 147 TYR n 1 148 HIS n 1 149 ASP n 1 150 GLY n 1 151 GLY n 1 152 MSE n 1 153 ARG n 1 154 GLU n 1 155 TYR n 1 156 PHE n 1 157 GLN n 1 158 ALA n 1 159 VAL n 1 160 GLY n 1 161 PRO n 1 162 ARG n 1 163 ILE n 1 164 THR n 1 165 ASP n 1 166 LEU n 1 167 ASN n 1 168 ASN n 1 169 LEU n 1 170 PRO n 1 171 GLU n 1 172 LEU n 1 173 THR n 1 174 ASN n 1 175 ALA n 1 176 GLN n 1 177 ARG n 1 178 ALA n 1 179 ALA n 1 180 PHE n 1 181 ALA n 1 182 SER n 1 183 GLU n 1 184 ALA n 1 185 PRO n 1 186 LYS n 1 187 TYR n 1 188 GLY n 1 189 ILE n 1 190 ASN n 1 191 GLN n 1 192 SER n 1 193 SER n 1 194 TYR n 1 195 PHE n 1 196 MSE n 1 197 GLU n 1 198 TYR n 1 199 VAL n 1 200 ASN n 1 201 THR n 1 202 ILE n 1 203 SER n 1 204 ASP n 1 205 LYS n 1 206 LEU n 1 207 PRO n 1 208 ALA n 1 209 GLN n 1 210 ILE n 1 211 ALA n 1 212 LYS n 1 213 LEU n 1 214 LYS n 1 215 ASN n 1 216 ASP n 1 217 LYS n 1 218 ASP n 1 219 LEU n 1 220 GLU n 1 221 ARG n 1 222 MSE n 1 223 VAL n 1 224 GLU n 1 225 VAL n 1 226 ILE n 1 227 GLU n 1 228 ALA n 1 229 PHE n 1 230 ASN n 1 231 ARG n 1 232 GLY n 1 233 ASP n 1 234 LYS n 1 235 SER n 1 236 VAL n 1 237 THR n 1 238 CYS n 1 239 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'SYNECHOCYSTIS SP. PCC 6803' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1148 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 27184 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET29A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P73600_SYNY3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P73600 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2XL7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 239 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P73600 _struct_ref_seq.db_align_beg 31 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 268 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 31 _struct_ref_seq.pdbx_auth_seq_align_end 268 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2XL7 _struct_ref_seq_dif.mon_id MSE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P73600 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 30 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 URE non-polymer . UREA ? 'C H4 N2 O' 60.055 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2XL7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.87 _exptl_crystal.density_percent_sol 68 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES PH 7.5, 20% (W/V) PEG 8000, 0.5MM CUSO4' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 _diffrn.pdbx_serial_crystal_experiment ? # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.979 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XL7 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 60.00 _reflns.d_resolution_high 2.40 _reflns.number_obs 18072 _reflns.number_all ? _reflns.percent_possible_obs 99.7 _reflns.pdbx_Rmerge_I_obs 0.10 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.60 _reflns.B_iso_Wilson_estimate 32 _reflns.pdbx_redundancy 6 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.40 _reflns_shell.d_res_low 2.53 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.34 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 4.90 _reflns_shell.pdbx_redundancy 6.1 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2XL7 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 17157 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 44.24 _refine.ls_d_res_high 2.40 _refine.ls_percent_reflns_obs 99.30 _refine.ls_R_factor_obs 0.17609 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.17417 _refine.ls_R_factor_R_free 0.21317 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 913 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.943 _refine.correlation_coeff_Fo_to_Fc_free 0.921 _refine.B_iso_mean 31.312 _refine.aniso_B[1][1] 0.28 _refine.aniso_B[2][2] 0.28 _refine.aniso_B[3][3] -0.42 _refine.aniso_B[1][2] 0.14 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. ; _refine.pdbx_starting_model 'PDB ENTRY 2XL9' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.205 _refine.pdbx_overall_ESU_R_Free 0.181 _refine.overall_SU_ML 0.110 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 9.986 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1848 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 197 _refine_hist.number_atoms_total 2052 _refine_hist.d_res_high 2.40 _refine_hist.d_res_low 44.24 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.012 0.022 ? 1916 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.298 1.952 ? 2616 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.229 5.000 ? 236 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.558 24.674 ? 92 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 12.567 15.000 ? 287 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 22.080 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.086 0.200 ? 274 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.006 0.022 ? 1524 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 0.566 1.500 ? 1186 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.117 2.000 ? 1922 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 1.872 3.000 ? 730 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 3.099 4.500 ? 693 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.400 _refine_ls_shell.d_res_low 2.462 _refine_ls_shell.number_reflns_R_work 1247 _refine_ls_shell.R_factor_R_work 0.192 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.238 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 68 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 2XL7 _struct.title 'Structure and metal-loading of a soluble periplasm cupro-protein: Cu- CucA-closed (SeMet)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XL7 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'METAL BINDING PROTEIN, CUPIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 151 ? GLY A 160 ? GLY A 180 GLY A 189 1 ? 10 HELX_P HELX_P2 2 THR A 173 ? GLU A 183 ? THR A 202 GLU A 212 1 ? 11 HELX_P HELX_P3 3 ALA A 184 ? TYR A 187 ? ALA A 213 TYR A 216 5 ? 4 HELX_P HELX_P4 4 TYR A 194 ? GLU A 197 ? TYR A 223 GLU A 226 5 ? 4 HELX_P HELX_P5 5 PRO A 207 ? LYS A 212 ? PRO A 236 LYS A 241 1 ? 6 HELX_P HELX_P6 6 ASN A 215 ? ARG A 231 ? ASN A 244 ARG A 260 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 238 SG ? ? A CYS 65 A CYS 267 1_555 ? ? ? ? ? ? ? 2.047 ? ? covale1 covale both ? A PRO 13 C ? ? ? 1_555 A MSE 14 N ? ? A PRO 42 A MSE 43 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale2 covale both ? A MSE 14 C ? ? ? 1_555 A PRO 15 N ? ? A MSE 43 A PRO 44 1_555 ? ? ? ? ? ? ? 1.354 ? ? covale3 covale both ? A PRO 56 C ? ? ? 1_555 A MSE 57 N ? ? A PRO 85 A MSE 86 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale4 covale both ? A MSE 57 C ? ? ? 1_555 A PRO 58 N ? ? A MSE 86 A PRO 87 1_555 ? ? ? ? ? ? ? 1.349 ? ? covale5 covale both ? A ASN 86 C ? ? ? 1_555 A MSE 87 N ? ? A ASN 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.339 ? ? covale6 covale both ? A MSE 87 C ? ? ? 1_555 A ASP 88 N ? ? A MSE 116 A ASP 117 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale7 covale both ? A TYR 118 C ? ? ? 1_555 A MSE 119 N ? ? A TYR 147 A MSE 148 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale8 covale both ? A MSE 119 C ? ? ? 1_555 A HIS 120 N ? ? A MSE 148 A HIS 149 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale9 covale both ? A TRP 136 C ? ? ? 1_555 A MSE 137 N ? ? A TRP 165 A MSE 166 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale10 covale both ? A MSE 137 C ? ? ? 1_555 A ARG 138 N ? ? A MSE 166 A ARG 167 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale11 covale both ? A GLY 151 C ? ? ? 1_555 A MSE 152 N ? ? A GLY 180 A MSE 181 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale12 covale both ? A MSE 152 C ? ? ? 1_555 A ARG 153 N ? ? A MSE 181 A ARG 182 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale13 covale both ? A PHE 195 C ? ? ? 1_555 A MSE 196 N ? ? A PHE 224 A MSE 225 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale14 covale both ? A MSE 196 C ? ? ? 1_555 A GLU 197 N ? ? A MSE 225 A GLU 226 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale15 covale both ? A ARG 221 C ? ? ? 1_555 A MSE 222 N ? ? A ARG 250 A MSE 251 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale16 covale both ? A MSE 222 C ? ? ? 1_555 A VAL 223 N ? ? A MSE 251 A VAL 252 1_555 ? ? ? ? ? ? ? 1.338 ? ? metalc1 metalc ? ? A HIS 7 ND1 ? ? ? 1_555 C CU . CU ? ? A HIS 36 A CU 1270 1_555 ? ? ? ? ? ? ? 1.874 ? ? metalc2 metalc ? ? A ASP 10 OD2 ? ? ? 11_555 C CU . CU ? ? A ASP 39 A CU 1270 1_555 ? ? ? ? ? ? ? 2.154 ? ? metalc3 metalc ? ? A HIS 59 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 88 A CU 1269 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc4 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 90 A CU 1269 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc5 metalc ? ? A GLU 66 OE1 ? ? ? 1_555 B CU . CU ? ? A GLU 95 A CU 1269 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc6 metalc ? ? A HIS 120 NE2 ? ? ? 1_555 B CU . CU ? ? A HIS 149 A CU 1269 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc7 metalc ? ? C CU . CU ? ? ? 1_555 F HOH . O ? ? A CU 1270 A HOH 2003 1_555 ? ? ? ? ? ? ? 2.638 ? ? metalc8 metalc ? ? C CU . CU ? ? ? 1_555 F HOH . O ? ? A CU 1270 A HOH 2005 11_555 ? ? ? ? ? ? ? 2.671 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 2 ? AB ? 6 ? AC ? 6 ? AD ? 2 ? AE ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? anti-parallel AB 5 6 ? parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AC 4 5 ? anti-parallel AC 5 6 ? anti-parallel AD 1 2 ? parallel AE 1 2 ? anti-parallel AE 2 3 ? anti-parallel AE 3 4 ? anti-parallel AE 4 5 ? anti-parallel AE 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 LEU A 21 ? THR A 25 ? LEU A 50 THR A 54 AA 2 GLU A 29 ? SER A 37 ? GLU A 58 SER A 66 AB 1 LEU A 111 ? SER A 114 ? LEU A 140 SER A 143 AB 2 ILE A 64 ? TRP A 69 ? ILE A 93 TRP A 98 AB 3 LEU A 130 ? ARG A 138 ? LEU A 159 ARG A 167 AB 4 GLY A 42 ? ILE A 50 ? GLY A 71 ILE A 79 AB 5 GLU A 29 ? SER A 37 ? GLU A 58 SER A 66 AB 6 THR A 237 ? CYS A 238 ? THR A 266 CYS A 267 AC 1 LEU A 111 ? SER A 114 ? LEU A 140 SER A 143 AC 2 ILE A 64 ? TRP A 69 ? ILE A 93 TRP A 98 AC 3 LEU A 130 ? ARG A 138 ? LEU A 159 ARG A 167 AC 4 GLY A 42 ? ILE A 50 ? GLY A 71 ILE A 79 AC 5 GLU A 29 ? SER A 37 ? GLU A 58 SER A 66 AC 6 LEU A 21 ? THR A 25 ? LEU A 50 THR A 54 AD 1 THR A 237 ? CYS A 238 ? THR A 266 CYS A 267 AD 2 GLU A 29 ? SER A 37 ? GLU A 58 SER A 66 AE 1 ILE A 189 ? GLN A 191 ? ILE A 218 GLN A 220 AE 2 HIS A 59 ? HIS A 61 ? HIS A 88 HIS A 90 AE 3 TYR A 118 ? VAL A 123 ? TYR A 147 VAL A 152 AE 4 GLU A 76 ? GLN A 83 ? GLU A 105 GLN A 112 AE 5 GLY A 99 ? GLN A 105 ? GLY A 128 GLN A 134 AE 6 VAL A 199 ? SER A 203 ? VAL A 228 SER A 232 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N THR A 25 ? N THR A 54 O GLU A 29 ? O GLU A 58 AB 1 2 N SER A 114 ? N SER A 143 O GLU A 66 ? O GLU A 95 AB 2 3 N TRP A 69 ? N TRP A 98 O VAL A 133 ? O VAL A 162 AB 3 4 N ARG A 138 ? N ARG A 167 O GLY A 42 ? O GLY A 71 AB 4 5 N GLN A 49 ? N GLN A 78 O ILE A 30 ? O ILE A 59 AB 5 6 N SER A 37 ? N SER A 66 O THR A 237 ? O THR A 266 AC 1 2 N SER A 114 ? N SER A 143 O GLU A 66 ? O GLU A 95 AC 2 3 N TRP A 69 ? N TRP A 98 O VAL A 133 ? O VAL A 162 AC 3 4 N ARG A 138 ? N ARG A 167 O GLY A 42 ? O GLY A 71 AC 4 5 N GLN A 49 ? N GLN A 78 O ILE A 30 ? O ILE A 59 AC 5 6 N ILE A 33 ? N ILE A 62 O LEU A 21 ? O LEU A 50 AD 1 2 N THR A 237 ? N THR A 266 O SER A 37 ? O SER A 66 AE 1 2 N ASN A 190 ? N ASN A 219 O ILE A 60 ? O ILE A 89 AE 2 3 N HIS A 61 ? N HIS A 90 O TYR A 118 ? O TYR A 147 AE 3 4 N VAL A 123 ? N VAL A 152 O GLU A 76 ? O GLU A 105 AE 4 5 N HIS A 79 ? N HIS A 108 O TYR A 102 ? O TYR A 131 AE 5 6 O GLY A 99 ? O GLY A 128 N ASN A 200 ? N ASN A 229 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CU 1269 ? 5 'BINDING SITE FOR RESIDUE CU A 1269' AC2 Software A CU 1270 ? 4 'BINDING SITE FOR RESIDUE CU A 1270' AC3 Software A URE 1271 ? 5 'BINDING SITE FOR RESIDUE URE A 1271' AC4 Software A CL 1272 ? 1 'BINDING SITE FOR RESIDUE CL A 1272' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 59 ? HIS A 88 . ? 1_555 ? 2 AC1 5 HIS A 61 ? HIS A 90 . ? 1_555 ? 3 AC1 5 GLU A 66 ? GLU A 95 . ? 1_555 ? 4 AC1 5 HIS A 120 ? HIS A 149 . ? 1_555 ? 5 AC1 5 HOH F . ? HOH A 2047 . ? 1_555 ? 6 AC2 4 HIS A 7 ? HIS A 36 . ? 1_555 ? 7 AC2 4 ASP A 10 ? ASP A 39 . ? 11_555 ? 8 AC2 4 HOH F . ? HOH A 2003 . ? 1_555 ? 9 AC2 4 HOH F . ? HOH A 2005 . ? 11_555 ? 10 AC3 5 GLU A 29 ? GLU A 58 . ? 1_555 ? 11 AC3 5 PRO A 56 ? PRO A 85 . ? 1_555 ? 12 AC3 5 PHE A 156 ? PHE A 185 . ? 1_555 ? 13 AC3 5 PHE A 180 ? PHE A 209 . ? 1_555 ? 14 AC3 5 HOH F . ? HOH A 2047 . ? 1_555 ? 15 AC4 1 ARG A 98 ? ARG A 127 . ? 1_555 ? # _database_PDB_matrix.entry_id 2XL7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XL7 _atom_sites.fract_transf_matrix[1][1] 0.011302 _atom_sites.fract_transf_matrix[1][2] 0.006525 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013050 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005197 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL CU N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 30 ? ? ? A . n A 1 2 ALA 2 31 ? ? ? A . n A 1 3 GLU 3 32 ? ? ? A . n A 1 4 THR 4 33 ? ? ? A . n A 1 5 GLU 5 34 34 GLU GLU A . n A 1 6 ILE 6 35 35 ILE ILE A . n A 1 7 HIS 7 36 36 HIS HIS A . n A 1 8 THR 8 37 37 THR THR A . n A 1 9 PHE 9 38 38 PHE PHE A . n A 1 10 ASP 10 39 39 ASP ASP A . n A 1 11 ASP 11 40 40 ASP ASP A . n A 1 12 ILE 12 41 41 ILE ILE A . n A 1 13 PRO 13 42 42 PRO PRO A . n A 1 14 MSE 14 43 43 MSE MSE A . n A 1 15 PRO 15 44 44 PRO PRO A . n A 1 16 LYS 16 45 45 LYS LYS A . n A 1 17 LEU 17 46 46 LEU LEU A . n A 1 18 ALA 18 47 47 ALA ALA A . n A 1 19 ASP 19 48 48 ASP ASP A . n A 1 20 PRO 20 49 49 PRO PRO A . n A 1 21 LEU 21 50 50 LEU LEU A . n A 1 22 LEU 22 51 51 LEU LEU A . n A 1 23 ILE 23 52 52 ILE ILE A . n A 1 24 TYR 24 53 53 TYR TYR A . n A 1 25 THR 25 54 54 THR THR A . n A 1 26 PRO 26 55 55 PRO PRO A . n A 1 27 ALA 27 56 56 ALA ALA A . n A 1 28 ASN 28 57 57 ASN ASN A . n A 1 29 GLU 29 58 58 GLU GLU A . n A 1 30 ILE 30 59 59 ILE ILE A . n A 1 31 PHE 31 60 60 PHE PHE A . n A 1 32 ASP 32 61 61 ASP ASP A . n A 1 33 ILE 33 62 62 ILE ILE A . n A 1 34 ALA 34 63 63 ALA ALA A . n A 1 35 SER 35 64 64 SER SER A . n A 1 36 CYS 36 65 65 CYS CYS A . n A 1 37 SER 37 66 66 SER SER A . n A 1 38 ALA 38 67 67 ALA ALA A . n A 1 39 LYS 39 68 68 LYS LYS A . n A 1 40 ASP 40 69 69 ASP ASP A . n A 1 41 ILE 41 70 70 ILE ILE A . n A 1 42 GLY 42 71 71 GLY GLY A . n A 1 43 PHE 43 72 72 PHE PHE A . n A 1 44 ALA 44 73 73 ALA ALA A . n A 1 45 ILE 45 74 74 ILE ILE A . n A 1 46 ALA 46 75 75 ALA ALA A . n A 1 47 HIS 47 76 76 HIS HIS A . n A 1 48 ALA 48 77 77 ALA ALA A . n A 1 49 GLN 49 78 78 GLN GLN A . n A 1 50 ILE 50 79 79 ILE ILE A . n A 1 51 PRO 51 80 80 PRO PRO A . n A 1 52 PRO 52 81 81 PRO PRO A . n A 1 53 GLY 53 82 82 GLY GLY A . n A 1 54 GLY 54 83 83 GLY GLY A . n A 1 55 GLY 55 84 84 GLY GLY A . n A 1 56 PRO 56 85 85 PRO PRO A . n A 1 57 MSE 57 86 86 MSE MSE A . n A 1 58 PRO 58 87 87 PRO PRO A . n A 1 59 HIS 59 88 88 HIS HIS A . n A 1 60 ILE 60 89 89 ILE ILE A . n A 1 61 HIS 61 90 90 HIS HIS A . n A 1 62 TYR 62 91 91 TYR TYR A . n A 1 63 PHE 63 92 92 PHE PHE A . n A 1 64 ILE 64 93 93 ILE ILE A . n A 1 65 ASN 65 94 94 ASN ASN A . n A 1 66 GLU 66 95 95 GLU GLU A . n A 1 67 TRP 67 96 96 TRP TRP A . n A 1 68 PHE 68 97 97 PHE PHE A . n A 1 69 TRP 69 98 98 TRP TRP A . n A 1 70 THR 70 99 99 THR THR A . n A 1 71 PRO 71 100 100 PRO PRO A . n A 1 72 GLU 72 101 101 GLU GLU A . n A 1 73 GLY 73 102 102 GLY GLY A . n A 1 74 GLY 74 103 103 GLY GLY A . n A 1 75 ILE 75 104 104 ILE ILE A . n A 1 76 GLU 76 105 105 GLU GLU A . n A 1 77 LEU 77 106 106 LEU LEU A . n A 1 78 PHE 78 107 107 PHE PHE A . n A 1 79 HIS 79 108 108 HIS HIS A . n A 1 80 SER 80 109 109 SER SER A . n A 1 81 THR 81 110 110 THR THR A . n A 1 82 LYS 82 111 111 LYS LYS A . n A 1 83 GLN 83 112 112 GLN GLN A . n A 1 84 TYR 84 113 113 TYR TYR A . n A 1 85 PRO 85 114 114 PRO PRO A . n A 1 86 ASN 86 115 115 ASN ASN A . n A 1 87 MSE 87 116 116 MSE MSE A . n A 1 88 ASP 88 117 117 ASP ASP A . n A 1 89 GLU 89 118 118 GLU GLU A . n A 1 90 LEU 90 119 119 LEU LEU A . n A 1 91 PRO 91 120 120 PRO PRO A . n A 1 92 VAL 92 121 121 VAL VAL A . n A 1 93 VAL 93 122 122 VAL VAL A . n A 1 94 GLY 94 123 123 GLY GLY A . n A 1 95 GLY 95 124 124 GLY GLY A . n A 1 96 ALA 96 125 125 ALA ALA A . n A 1 97 GLY 97 126 126 GLY GLY A . n A 1 98 ARG 98 127 127 ARG ARG A . n A 1 99 GLY 99 128 128 GLY GLY A . n A 1 100 ASP 100 129 129 ASP ASP A . n A 1 101 LEU 101 130 130 LEU LEU A . n A 1 102 TYR 102 131 131 TYR TYR A . n A 1 103 SER 103 132 132 SER SER A . n A 1 104 ILE 104 133 133 ILE ILE A . n A 1 105 GLN 105 134 134 GLN GLN A . n A 1 106 SER 106 135 135 SER SER A . n A 1 107 GLU 107 136 136 GLU GLU A . n A 1 108 PRO 108 137 137 PRO PRO A . n A 1 109 LYS 109 138 138 LYS LYS A . n A 1 110 GLN 110 139 139 GLN GLN A . n A 1 111 LEU 111 140 140 LEU LEU A . n A 1 112 ILE 112 141 141 ILE ILE A . n A 1 113 TYR 113 142 142 TYR TYR A . n A 1 114 SER 114 143 143 SER SER A . n A 1 115 PRO 115 144 144 PRO PRO A . n A 1 116 ASN 116 145 145 ASN ASN A . n A 1 117 HIS 117 146 146 HIS HIS A . n A 1 118 TYR 118 147 147 TYR TYR A . n A 1 119 MSE 119 148 148 MSE MSE A . n A 1 120 HIS 120 149 149 HIS HIS A . n A 1 121 GLY 121 150 150 GLY GLY A . n A 1 122 PHE 122 151 151 PHE PHE A . n A 1 123 VAL 123 152 152 VAL VAL A . n A 1 124 ASN 124 153 153 ASN ASN A . n A 1 125 PRO 125 154 154 PRO PRO A . n A 1 126 THR 126 155 155 THR THR A . n A 1 127 ASP 127 156 156 ASP ASP A . n A 1 128 LYS 128 157 157 LYS LYS A . n A 1 129 THR 129 158 158 THR THR A . n A 1 130 LEU 130 159 159 LEU LEU A . n A 1 131 PRO 131 160 160 PRO PRO A . n A 1 132 ILE 132 161 161 ILE ILE A . n A 1 133 VAL 133 162 162 VAL VAL A . n A 1 134 PHE 134 163 163 PHE PHE A . n A 1 135 VAL 135 164 164 VAL VAL A . n A 1 136 TRP 136 165 165 TRP TRP A . n A 1 137 MSE 137 166 166 MSE MSE A . n A 1 138 ARG 138 167 167 ARG ARG A . n A 1 139 ASN 139 168 168 ASN ASN A . n A 1 140 GLU 140 169 169 GLU GLU A . n A 1 141 VAL 141 170 170 VAL VAL A . n A 1 142 ALA 142 171 171 ALA ALA A . n A 1 143 PRO 143 172 172 PRO PRO A . n A 1 144 ASP 144 173 173 ASP ASP A . n A 1 145 PHE 145 174 174 PHE PHE A . n A 1 146 PRO 146 175 175 PRO PRO A . n A 1 147 TYR 147 176 176 TYR TYR A . n A 1 148 HIS 148 177 177 HIS HIS A . n A 1 149 ASP 149 178 178 ASP ASP A . n A 1 150 GLY 150 179 179 GLY GLY A . n A 1 151 GLY 151 180 180 GLY GLY A . n A 1 152 MSE 152 181 181 MSE MSE A . n A 1 153 ARG 153 182 182 ARG ARG A . n A 1 154 GLU 154 183 183 GLU GLU A . n A 1 155 TYR 155 184 184 TYR TYR A . n A 1 156 PHE 156 185 185 PHE PHE A . n A 1 157 GLN 157 186 186 GLN GLN A . n A 1 158 ALA 158 187 187 ALA ALA A . n A 1 159 VAL 159 188 188 VAL VAL A . n A 1 160 GLY 160 189 189 GLY GLY A . n A 1 161 PRO 161 190 190 PRO PRO A . n A 1 162 ARG 162 191 191 ARG ARG A . n A 1 163 ILE 163 192 192 ILE ILE A . n A 1 164 THR 164 193 193 THR THR A . n A 1 165 ASP 165 194 194 ASP ASP A . n A 1 166 LEU 166 195 195 LEU LEU A . n A 1 167 ASN 167 196 196 ASN ASN A . n A 1 168 ASN 168 197 197 ASN ASN A . n A 1 169 LEU 169 198 198 LEU LEU A . n A 1 170 PRO 170 199 199 PRO PRO A . n A 1 171 GLU 171 200 200 GLU GLU A . n A 1 172 LEU 172 201 201 LEU LEU A . n A 1 173 THR 173 202 202 THR THR A . n A 1 174 ASN 174 203 203 ASN ASN A . n A 1 175 ALA 175 204 204 ALA ALA A . n A 1 176 GLN 176 205 205 GLN GLN A . n A 1 177 ARG 177 206 206 ARG ARG A . n A 1 178 ALA 178 207 207 ALA ALA A . n A 1 179 ALA 179 208 208 ALA ALA A . n A 1 180 PHE 180 209 209 PHE PHE A . n A 1 181 ALA 181 210 210 ALA ALA A . n A 1 182 SER 182 211 211 SER SER A . n A 1 183 GLU 183 212 212 GLU GLU A . n A 1 184 ALA 184 213 213 ALA ALA A . n A 1 185 PRO 185 214 214 PRO PRO A . n A 1 186 LYS 186 215 215 LYS LYS A . n A 1 187 TYR 187 216 216 TYR TYR A . n A 1 188 GLY 188 217 217 GLY GLY A . n A 1 189 ILE 189 218 218 ILE ILE A . n A 1 190 ASN 190 219 219 ASN ASN A . n A 1 191 GLN 191 220 220 GLN GLN A . n A 1 192 SER 192 221 221 SER SER A . n A 1 193 SER 193 222 222 SER SER A . n A 1 194 TYR 194 223 223 TYR TYR A . n A 1 195 PHE 195 224 224 PHE PHE A . n A 1 196 MSE 196 225 225 MSE MSE A . n A 1 197 GLU 197 226 226 GLU GLU A . n A 1 198 TYR 198 227 227 TYR TYR A . n A 1 199 VAL 199 228 228 VAL VAL A . n A 1 200 ASN 200 229 229 ASN ASN A . n A 1 201 THR 201 230 230 THR THR A . n A 1 202 ILE 202 231 231 ILE ILE A . n A 1 203 SER 203 232 232 SER SER A . n A 1 204 ASP 204 233 233 ASP ASP A . n A 1 205 LYS 205 234 234 LYS LYS A . n A 1 206 LEU 206 235 235 LEU LEU A . n A 1 207 PRO 207 236 236 PRO PRO A . n A 1 208 ALA 208 237 237 ALA ALA A . n A 1 209 GLN 209 238 238 GLN GLN A . n A 1 210 ILE 210 239 239 ILE ILE A . n A 1 211 ALA 211 240 240 ALA ALA A . n A 1 212 LYS 212 241 241 LYS LYS A . n A 1 213 LEU 213 242 242 LEU LEU A . n A 1 214 LYS 214 243 243 LYS LYS A . n A 1 215 ASN 215 244 244 ASN ASN A . n A 1 216 ASP 216 245 245 ASP ASP A . n A 1 217 LYS 217 246 246 LYS LYS A . n A 1 218 ASP 218 247 247 ASP ASP A . n A 1 219 LEU 219 248 248 LEU LEU A . n A 1 220 GLU 220 249 249 GLU GLU A . n A 1 221 ARG 221 250 250 ARG ARG A . n A 1 222 MSE 222 251 251 MSE MSE A . n A 1 223 VAL 223 252 252 VAL VAL A . n A 1 224 GLU 224 253 253 GLU GLU A . n A 1 225 VAL 225 254 254 VAL VAL A . n A 1 226 ILE 226 255 255 ILE ILE A . n A 1 227 GLU 227 256 256 GLU GLU A . n A 1 228 ALA 228 257 257 ALA ALA A . n A 1 229 PHE 229 258 258 PHE PHE A . n A 1 230 ASN 230 259 259 ASN ASN A . n A 1 231 ARG 231 260 260 ARG ARG A . n A 1 232 GLY 232 261 261 GLY GLY A . n A 1 233 ASP 233 262 262 ASP ASP A . n A 1 234 LYS 234 263 263 LYS LYS A . n A 1 235 SER 235 264 264 SER SER A . n A 1 236 VAL 236 265 265 VAL VAL A . n A 1 237 THR 237 266 266 THR THR A . n A 1 238 CYS 238 267 267 CYS CYS A . n A 1 239 SER 239 268 268 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 1269 1269 CU CU A . C 2 CU 1 1270 1270 CU CU A . D 3 URE 1 1271 1271 URE URE A . E 4 CL 1 1272 1272 CL CL A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . F 5 HOH 173 2173 2173 HOH HOH A . F 5 HOH 174 2174 2174 HOH HOH A . F 5 HOH 175 2175 2175 HOH HOH A . F 5 HOH 176 2176 2176 HOH HOH A . F 5 HOH 177 2177 2177 HOH HOH A . F 5 HOH 178 2178 2178 HOH HOH A . F 5 HOH 179 2179 2179 HOH HOH A . F 5 HOH 180 2180 2180 HOH HOH A . F 5 HOH 181 2181 2181 HOH HOH A . F 5 HOH 182 2182 2182 HOH HOH A . F 5 HOH 183 2183 2183 HOH HOH A . F 5 HOH 184 2184 2184 HOH HOH A . F 5 HOH 185 2185 2185 HOH HOH A . F 5 HOH 186 2186 2186 HOH HOH A . F 5 HOH 187 2187 2187 HOH HOH A . F 5 HOH 188 2188 2188 HOH HOH A . F 5 HOH 189 2189 2189 HOH HOH A . F 5 HOH 190 2190 2190 HOH HOH A . F 5 HOH 191 2191 2191 HOH HOH A . F 5 HOH 192 2192 2192 HOH HOH A . F 5 HOH 193 2193 2193 HOH HOH A . F 5 HOH 194 2194 2194 HOH HOH A . F 5 HOH 195 2195 2195 HOH HOH A . F 5 HOH 196 2196 2196 HOH HOH A . F 5 HOH 197 2197 2197 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 14 A MSE 43 ? MET SELENOMETHIONINE 2 A MSE 57 A MSE 86 ? MET SELENOMETHIONINE 3 A MSE 87 A MSE 116 ? MET SELENOMETHIONINE 4 A MSE 119 A MSE 148 ? MET SELENOMETHIONINE 5 A MSE 137 A MSE 166 ? MET SELENOMETHIONINE 6 A MSE 152 A MSE 181 ? MET SELENOMETHIONINE 7 A MSE 196 A MSE 225 ? MET SELENOMETHIONINE 8 A MSE 222 A MSE 251 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2960 ? 1 MORE -63.1 ? 1 'SSA (A^2)' 19100 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_665 -x+1,-y+1,z -1.0000000000 0.0000000000 0.0000000000 44.2415000000 0.0000000000 -1.0000000000 0.0000000000 76.6285258031 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2080 ? F HOH . 2 1 A HOH 2188 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 ND1 ? A HIS 7 ? A HIS 36 ? 1_555 CU ? C CU . ? A CU 1270 ? 1_555 OD2 ? A ASP 10 ? A ASP 39 ? 11_555 93.4 ? 2 ND1 ? A HIS 7 ? A HIS 36 ? 1_555 CU ? C CU . ? A CU 1270 ? 1_555 O ? F HOH . ? A HOH 2003 ? 1_555 157.8 ? 3 OD2 ? A ASP 10 ? A ASP 39 ? 11_555 CU ? C CU . ? A CU 1270 ? 1_555 O ? F HOH . ? A HOH 2003 ? 1_555 108.8 ? 4 ND1 ? A HIS 7 ? A HIS 36 ? 1_555 CU ? C CU . ? A CU 1270 ? 1_555 O ? F HOH . ? A HOH 2005 ? 11_555 98.2 ? 5 OD2 ? A ASP 10 ? A ASP 39 ? 11_555 CU ? C CU . ? A CU 1270 ? 1_555 O ? F HOH . ? A HOH 2005 ? 11_555 79.0 ? 6 O ? F HOH . ? A HOH 2003 ? 1_555 CU ? C CU . ? A CU 1270 ? 1_555 O ? F HOH . ? A HOH 2005 ? 11_555 88.0 ? 7 NE2 ? A HIS 59 ? A HIS 88 ? 1_555 CU ? B CU . ? A CU 1269 ? 1_555 NE2 ? A HIS 61 ? A HIS 90 ? 1_555 95.6 ? 8 NE2 ? A HIS 59 ? A HIS 88 ? 1_555 CU ? B CU . ? A CU 1269 ? 1_555 OE1 ? A GLU 66 ? A GLU 95 ? 1_555 172.4 ? 9 NE2 ? A HIS 61 ? A HIS 90 ? 1_555 CU ? B CU . ? A CU 1269 ? 1_555 OE1 ? A GLU 66 ? A GLU 95 ? 1_555 88.7 ? 10 NE2 ? A HIS 59 ? A HIS 88 ? 1_555 CU ? B CU . ? A CU 1269 ? 1_555 NE2 ? A HIS 120 ? A HIS 149 ? 1_555 94.4 ? 11 NE2 ? A HIS 61 ? A HIS 90 ? 1_555 CU ? B CU . ? A CU 1269 ? 1_555 NE2 ? A HIS 120 ? A HIS 149 ? 1_555 102.3 ? 12 OE1 ? A GLU 66 ? A GLU 95 ? 1_555 CU ? B CU . ? A CU 1269 ? 1_555 NE2 ? A HIS 120 ? A HIS 149 ? 1_555 78.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-11 2 'Structure model' 1 1 2011-05-12 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_database_status 5 4 'Structure model' pdbx_initial_refinement_model 6 4 'Structure model' pdbx_struct_conn_angle 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_sf' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 20 4 'Structure model' '_pdbx_struct_conn_angle.value' 21 4 'Structure model' '_struct_conn.pdbx_dist_value' 22 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 29 4 'Structure model' '_struct_conn.ptnr1_symmetry' 30 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 31 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 36 4 'Structure model' '_struct_conn.ptnr2_symmetry' 37 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 15.6985 _pdbx_refine_tls.origin_y 21.6162 _pdbx_refine_tls.origin_z 11.5584 _pdbx_refine_tls.T[1][1] 0.0041 _pdbx_refine_tls.T[2][2] 0.0005 _pdbx_refine_tls.T[3][3] 0.0022 _pdbx_refine_tls.T[1][2] -0.0014 _pdbx_refine_tls.T[1][3] -0.0002 _pdbx_refine_tls.T[2][3] 0.0004 _pdbx_refine_tls.L[1][1] 0.1853 _pdbx_refine_tls.L[2][2] 0.2320 _pdbx_refine_tls.L[3][3] 0.1523 _pdbx_refine_tls.L[1][2] 0.1225 _pdbx_refine_tls.L[1][3] -0.0429 _pdbx_refine_tls.L[2][3] -0.0241 _pdbx_refine_tls.S[1][1] 0.0031 _pdbx_refine_tls.S[1][2] -0.0035 _pdbx_refine_tls.S[1][3] -0.0152 _pdbx_refine_tls.S[2][1] -0.0204 _pdbx_refine_tls.S[2][2] 0.0044 _pdbx_refine_tls.S[2][3] -0.0148 _pdbx_refine_tls.S[3][1] 0.0069 _pdbx_refine_tls.S[3][2] -0.0029 _pdbx_refine_tls.S[3][3] -0.0075 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 34 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 268 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement 5.5.0070 ? 1 ? ? ? ? MOSFLM 'data reduction' . ? 2 ? ? ? ? SCALA 'data scaling' . ? 3 ? ? ? ? MOLREP phasing . ? 4 ? ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 146 ? ? 93.74 -14.35 2 1 ASN A 244 ? ? -153.40 71.68 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 45 ? CD ? A LYS 16 CD 2 1 Y 1 A LYS 45 ? CE ? A LYS 16 CE 3 1 Y 1 A LYS 45 ? NZ ? A LYS 16 NZ 4 1 Y 1 A ASP 48 ? CG ? A ASP 19 CG 5 1 Y 1 A ASP 48 ? OD1 ? A ASP 19 OD1 6 1 Y 1 A ASP 48 ? OD2 ? A ASP 19 OD2 7 1 Y 1 A LYS 68 ? CG ? A LYS 39 CG 8 1 Y 1 A LYS 68 ? CD ? A LYS 39 CD 9 1 Y 1 A LYS 68 ? CE ? A LYS 39 CE 10 1 Y 1 A LYS 68 ? NZ ? A LYS 39 NZ 11 1 Y 1 A LYS 157 ? CE ? A LYS 128 CE 12 1 Y 1 A LYS 157 ? NZ ? A LYS 128 NZ 13 1 Y 1 A LYS 234 ? CD ? A LYS 205 CD 14 1 Y 1 A LYS 234 ? CE ? A LYS 205 CE 15 1 Y 1 A LYS 234 ? NZ ? A LYS 205 NZ 16 1 Y 1 A LYS 243 ? CE ? A LYS 214 CE 17 1 Y 1 A LYS 243 ? NZ ? A LYS 214 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 30 ? A MSE 1 2 1 Y 1 A ALA 31 ? A ALA 2 3 1 Y 1 A GLU 32 ? A GLU 3 4 1 Y 1 A THR 33 ? A THR 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CU CU CU N N 75 CYS N N N N 76 CYS CA C N R 77 CYS C C N N 78 CYS O O N N 79 CYS CB C N N 80 CYS SG S N N 81 CYS OXT O N N 82 CYS H H N N 83 CYS H2 H N N 84 CYS HA H N N 85 CYS HB2 H N N 86 CYS HB3 H N N 87 CYS HG H N N 88 CYS HXT H N N 89 GLN N N N N 90 GLN CA C N S 91 GLN C C N N 92 GLN O O N N 93 GLN CB C N N 94 GLN CG C N N 95 GLN CD C N N 96 GLN OE1 O N N 97 GLN NE2 N N N 98 GLN OXT O N N 99 GLN H H N N 100 GLN H2 H N N 101 GLN HA H N N 102 GLN HB2 H N N 103 GLN HB3 H N N 104 GLN HG2 H N N 105 GLN HG3 H N N 106 GLN HE21 H N N 107 GLN HE22 H N N 108 GLN HXT H N N 109 GLU N N N N 110 GLU CA C N S 111 GLU C C N N 112 GLU O O N N 113 GLU CB C N N 114 GLU CG C N N 115 GLU CD C N N 116 GLU OE1 O N N 117 GLU OE2 O N N 118 GLU OXT O N N 119 GLU H H N N 120 GLU H2 H N N 121 GLU HA H N N 122 GLU HB2 H N N 123 GLU HB3 H N N 124 GLU HG2 H N N 125 GLU HG3 H N N 126 GLU HE2 H N N 127 GLU HXT H N N 128 GLY N N N N 129 GLY CA C N N 130 GLY C C N N 131 GLY O O N N 132 GLY OXT O N N 133 GLY H H N N 134 GLY H2 H N N 135 GLY HA2 H N N 136 GLY HA3 H N N 137 GLY HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MSE N N N N 232 MSE CA C N S 233 MSE C C N N 234 MSE O O N N 235 MSE OXT O N N 236 MSE CB C N N 237 MSE CG C N N 238 MSE SE SE N N 239 MSE CE C N N 240 MSE H H N N 241 MSE H2 H N N 242 MSE HA H N N 243 MSE HXT H N N 244 MSE HB2 H N N 245 MSE HB3 H N N 246 MSE HG2 H N N 247 MSE HG3 H N N 248 MSE HE1 H N N 249 MSE HE2 H N N 250 MSE HE3 H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 URE C C N N 374 URE O O N N 375 URE N1 N N N 376 URE N2 N N N 377 URE HN11 H N N 378 URE HN12 H N N 379 URE HN21 H N N 380 URE HN22 H N N 381 VAL N N N N 382 VAL CA C N S 383 VAL C C N N 384 VAL O O N N 385 VAL CB C N N 386 VAL CG1 C N N 387 VAL CG2 C N N 388 VAL OXT O N N 389 VAL H H N N 390 VAL H2 H N N 391 VAL HA H N N 392 VAL HB H N N 393 VAL HG11 H N N 394 VAL HG12 H N N 395 VAL HG13 H N N 396 VAL HG21 H N N 397 VAL HG22 H N N 398 VAL HG23 H N N 399 VAL HXT H N N 400 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 URE C O doub N N 358 URE C N1 sing N N 359 URE C N2 sing N N 360 URE N1 HN11 sing N N 361 URE N1 HN12 sing N N 362 URE N2 HN21 sing N N 363 URE N2 HN22 sing N N 364 VAL N CA sing N N 365 VAL N H sing N N 366 VAL N H2 sing N N 367 VAL CA C sing N N 368 VAL CA CB sing N N 369 VAL CA HA sing N N 370 VAL C O doub N N 371 VAL C OXT sing N N 372 VAL CB CG1 sing N N 373 VAL CB CG2 sing N N 374 VAL CB HB sing N N 375 VAL CG1 HG11 sing N N 376 VAL CG1 HG12 sing N N 377 VAL CG1 HG13 sing N N 378 VAL CG2 HG21 sing N N 379 VAL CG2 HG22 sing N N 380 VAL CG2 HG23 sing N N 381 VAL OXT HXT sing N N 382 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 UREA URE 4 'CHLORIDE ION' CL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2XL9 _pdbx_initial_refinement_model.details 'PDB ENTRY 2XL9' #