data_2XRU # _entry.id 2XRU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.305 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2XRU PDBE EBI-45449 WWPDB D_1290045449 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1MUO unspecified 'CRYSTAL STRUCTURE OF AURORA-2, AN ONCOGENIC SERINE-THREONINE KINASE' PDB 2X6D unspecified 'AURORA-A BOUND TO AN INHIBITOR' PDB 2J50 unspecified 'STRUCTURE OF AURORA-2 IN COMPLEX WITH PHA -739358' PDB 2W1D unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 1OL6 unspecified 'STRUCTURE OF UNPHOSPHORYLATED D274N MUTANT OF AURORA-A' PDB 2XNE unspecified 'STRUCTURE OF AURORA-A BOUND TO AN IMIDAZOPYRAZINE INHIBITOR' PDB 2BMC unspecified 'AURORA-2 T287D T288D COMPLEXED WITH PHA- 680632' PDB 2C6E unspecified 'AURORA A KINASE ACTIVATED MUTANT (T287D) IN COMPLEX WITH A 5-AMINOPYRIMIDINYL QUINAZOLINE INHIBITOR' PDB 2J4Z unspecified 'STRUCTURE OF AURORA-2 IN COMPLEX WITH PHA -680626' PDB 1OL5 unspecified 'STRUCTURE OF AURORA-A 122-403, PHOSPHORYLATED ON THR287, THR288 AND BOUND TO TPX2 1-43' PDB 2X81 unspecified 'STRUCTURE OF AURORA A IN COMPLEX WITH MLN8054' PDB 2XNG unspecified 'STRUCTURE OF AURORA-A BOUND TO A SELECTIVE IMIDAZOPYRAZINE INHIBITOR' PDB 2C6D unspecified 'AURORA A KINASE ACTIVATED MUTANT (T287D) IN COMPLEX WITH ADPNP' PDB 2WTW unspecified 'AURORA-A INHIBITOR STRUCTURE (2ND CRYSTAL FORM)' PDB 2WQE unspecified 'STRUCTURE OF S155R AURORA-A SOMATIC MUTANT' PDB 2W1C unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2W1G unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2WTV unspecified 'AURORA-A INHIBITOR STRUCTURE' PDB 1OL7 unspecified 'STRUCTURE OF HUMAN AURORA-A 122-403 PHOSPHORYLATED ON THR287, THR288' PDB 2W1E unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2W1F unspecified 'STRUCTURE DETERMINATION OF AURORA KINASE IN COMPLEX WITH INHIBITOR' PDB 2X6E unspecified 'AURORA-A BOUND TO AN INHIBITOR' PDB 1MQ4 unspecified 'CRYSTAL STRUCTURE OF AURORA-A PROTEIN KINASE' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XRU _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-09-22 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bindi, S.' 1 'Fancelli, D.' 2 'Alli, C.' 3 'Berta, D.' 4 'Bertrand, J.A.' 5 'Cameron, A.D.' 6 'Cappella, P.' 7 'Carpinelli, P.' 8 'Cervi, G.' 9 'Croci, W.' 10 ;D'Anello, M. ; 11 'Forte, B.' 12 'LauraGiorgini, M.' 13 'Marsiglio, A.' 14 'Moll, J.' 15 'Pesenti, E.' 16 'Pittala, V.' 17 'Pulici, M.' 18 'Riccardi-Sirtori, F.' 19 'Roletto, F.' 20 'Soncini, C.' 21 'Storici, P.' 22 'Varasi, M.' 23 'Volpi, D.' 24 'Zugnoni, P.' 25 'Vianello, P.' 26 # _citation.id primary _citation.title 'Thieno[3,2-C]Pyrazoles: A Novel Class of Aurora Inhibitors with Favorable Antitumor Activity.' _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_volume 18 _citation.page_first 7113 _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 0968-0896 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20817473 _citation.pdbx_database_id_DOI 10.1016/J.BMC.2010.07.048 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bindi, S.' 1 ? primary 'Fancelli, D.' 2 ? primary 'Alli, C.' 3 ? primary 'Berta, D.' 4 ? primary 'Bertrand, J.A.' 5 ? primary 'Cameron, A.D.' 6 ? primary 'Cappella, P.' 7 ? primary 'Carpinelli, P.' 8 ? primary 'Cervi, G.' 9 ? primary 'Croci, V.' 10 ? primary ;D'Anello, M. ; 11 ? primary 'Forte, B.' 12 ? primary 'Laura Giorgini, M.' 13 ? primary 'Marsiglio, A.' 14 ? primary 'Moll, J.' 15 ? primary 'Pesenti, E.' 16 ? primary 'Pittala, V.' 17 ? primary 'Pulici, M.' 18 ? primary 'Riccardi-Sirtori, F.' 19 ? primary 'Roletto, F.' 20 ? primary 'Soncini, C.' 21 ? primary 'Storici, P.' 22 ? primary 'Varasi, M.' 23 ? primary 'Volpi, D.' 24 ? primary 'Zugnoni, P.' 25 ? primary 'Vianello, P.' 26 ? # _cell.entry_id 2XRU _cell.length_a 82.467 _cell.length_b 82.467 _cell.length_c 165.453 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XRU _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'SERINE/THREONINE-PROTEIN KINASE 6' 32397.084 1 2.7.11.1 YES 'CATALYTIC DOMAIN, RESIDUES 126-403' ? 2 non-polymer syn '3-({[4-(4-METHYLPIPERAZIN-1-YL)PHENYL]CARBONYL}AMINO)-N-[(1R)-1-PHENYLPROPYL]-1H-THIENO[3,2-C]PYRAZOLE-5-CARBOXAMIDE' 502.631 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;AURORA KINASE A, SERINE/THREONINE KINASE 15, AURORA/IPL1-RELATED KINASE 1, BREAST TUMOR-AMPLIFIED KINASE, AURORA-A, AURORA-RELATED KINASE 1, HARK1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS SRRTELCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL LKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS ; _entity_poly.pdbx_seq_one_letter_code_can ;GPRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDA TRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPS SRRTELCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRL LKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ARG n 1 4 GLN n 1 5 TRP n 1 6 ALA n 1 7 LEU n 1 8 GLU n 1 9 ASP n 1 10 PHE n 1 11 GLU n 1 12 ILE n 1 13 GLY n 1 14 ARG n 1 15 PRO n 1 16 LEU n 1 17 GLY n 1 18 LYS n 1 19 GLY n 1 20 LYS n 1 21 PHE n 1 22 GLY n 1 23 ASN n 1 24 VAL n 1 25 TYR n 1 26 LEU n 1 27 ALA n 1 28 ARG n 1 29 GLU n 1 30 LYS n 1 31 GLN n 1 32 SER n 1 33 LYS n 1 34 PHE n 1 35 ILE n 1 36 LEU n 1 37 ALA n 1 38 LEU n 1 39 LYS n 1 40 VAL n 1 41 LEU n 1 42 PHE n 1 43 LYS n 1 44 ALA n 1 45 GLN n 1 46 LEU n 1 47 GLU n 1 48 LYS n 1 49 ALA n 1 50 GLY n 1 51 VAL n 1 52 GLU n 1 53 HIS n 1 54 GLN n 1 55 LEU n 1 56 ARG n 1 57 ARG n 1 58 GLU n 1 59 VAL n 1 60 GLU n 1 61 ILE n 1 62 GLN n 1 63 SER n 1 64 HIS n 1 65 LEU n 1 66 ARG n 1 67 HIS n 1 68 PRO n 1 69 ASN n 1 70 ILE n 1 71 LEU n 1 72 ARG n 1 73 LEU n 1 74 TYR n 1 75 GLY n 1 76 TYR n 1 77 PHE n 1 78 HIS n 1 79 ASP n 1 80 ALA n 1 81 THR n 1 82 ARG n 1 83 VAL n 1 84 TYR n 1 85 LEU n 1 86 ILE n 1 87 LEU n 1 88 GLU n 1 89 TYR n 1 90 ALA n 1 91 PRO n 1 92 LEU n 1 93 GLY n 1 94 THR n 1 95 VAL n 1 96 TYR n 1 97 ARG n 1 98 GLU n 1 99 LEU n 1 100 GLN n 1 101 LYS n 1 102 LEU n 1 103 SER n 1 104 LYS n 1 105 PHE n 1 106 ASP n 1 107 GLU n 1 108 GLN n 1 109 ARG n 1 110 THR n 1 111 ALA n 1 112 THR n 1 113 TYR n 1 114 ILE n 1 115 THR n 1 116 GLU n 1 117 LEU n 1 118 ALA n 1 119 ASN n 1 120 ALA n 1 121 LEU n 1 122 SER n 1 123 TYR n 1 124 CYS n 1 125 HIS n 1 126 SER n 1 127 LYS n 1 128 ARG n 1 129 VAL n 1 130 ILE n 1 131 HIS n 1 132 ARG n 1 133 ASP n 1 134 ILE n 1 135 LYS n 1 136 PRO n 1 137 GLU n 1 138 ASN n 1 139 LEU n 1 140 LEU n 1 141 LEU n 1 142 GLY n 1 143 SER n 1 144 ALA n 1 145 GLY n 1 146 GLU n 1 147 LEU n 1 148 LYS n 1 149 ILE n 1 150 ALA n 1 151 ASP n 1 152 PHE n 1 153 GLY n 1 154 TRP n 1 155 SER n 1 156 VAL n 1 157 HIS n 1 158 ALA n 1 159 PRO n 1 160 SER n 1 161 SER n 1 162 ARG n 1 163 ARG n 1 164 THR n 1 165 GLU n 1 166 LEU n 1 167 CYS n 1 168 GLY n 1 169 THR n 1 170 LEU n 1 171 ASP n 1 172 TYR n 1 173 LEU n 1 174 PRO n 1 175 PRO n 1 176 GLU n 1 177 MET n 1 178 ILE n 1 179 GLU n 1 180 GLY n 1 181 ARG n 1 182 MET n 1 183 HIS n 1 184 ASP n 1 185 GLU n 1 186 LYS n 1 187 VAL n 1 188 ASP n 1 189 LEU n 1 190 TRP n 1 191 SER n 1 192 LEU n 1 193 GLY n 1 194 VAL n 1 195 LEU n 1 196 CYS n 1 197 TYR n 1 198 GLU n 1 199 PHE n 1 200 LEU n 1 201 VAL n 1 202 GLY n 1 203 LYS n 1 204 PRO n 1 205 PRO n 1 206 PHE n 1 207 GLU n 1 208 ALA n 1 209 ASN n 1 210 THR n 1 211 TYR n 1 212 GLN n 1 213 GLU n 1 214 THR n 1 215 TYR n 1 216 LYS n 1 217 ARG n 1 218 ILE n 1 219 SER n 1 220 ARG n 1 221 VAL n 1 222 GLU n 1 223 PHE n 1 224 THR n 1 225 PHE n 1 226 PRO n 1 227 ASP n 1 228 PHE n 1 229 VAL n 1 230 THR n 1 231 GLU n 1 232 GLY n 1 233 ALA n 1 234 ARG n 1 235 ASP n 1 236 LEU n 1 237 ILE n 1 238 SER n 1 239 ARG n 1 240 LEU n 1 241 LEU n 1 242 LYS n 1 243 HIS n 1 244 ASN n 1 245 PRO n 1 246 SER n 1 247 GLN n 1 248 ARG n 1 249 PRO n 1 250 MET n 1 251 LEU n 1 252 ARG n 1 253 GLU n 1 254 VAL n 1 255 LEU n 1 256 GLU n 1 257 HIS n 1 258 PRO n 1 259 TRP n 1 260 ILE n 1 261 THR n 1 262 ALA n 1 263 ASN n 1 264 SER n 1 265 SER n 1 266 LYS n 1 267 PRO n 1 268 SER n 1 269 ASN n 1 270 CYS n 1 271 GLN n 1 272 ASN n 1 273 LYS n 1 274 GLU n 1 275 SER n 1 276 ALA n 1 277 SER n 1 278 LYS n 1 279 GLN n 1 280 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'FALL ARMYWORM' _entity_src_gen.pdbx_host_org_scientific_name 'SPODOPTERA FRUGIPERDA' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'High Five' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type BACULOVIRUS _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STK6_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession O14965 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2XRU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 280 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O14965 _struct_ref_seq.db_align_beg 126 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 403 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 126 _struct_ref_seq.pdbx_auth_seq_align_end 403 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2XRU GLY A 1 ? UNP O14965 ? ? 'expression tag' 124 1 1 2XRU PRO A 2 ? UNP O14965 ? ? 'expression tag' 125 2 1 2XRU GLU A 165 ? UNP O14965 THR 288 'engineered mutation' 288 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 400 non-polymer . '3-({[4-(4-METHYLPIPERAZIN-1-YL)PHENYL]CARBONYL}AMINO)-N-[(1R)-1-PHENYLPROPYL]-1H-THIENO[3,2-C]PYRAZOLE-5-CARBOXAMIDE' PHA-828300 'C27 H30 N6 O2 S' 502.631 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2XRU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.74 _exptl_crystal.density_percent_sol 54.7 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '15% PEG 5000 MME, 0.2 M LITHIUM SULFATE, 0.1 M SODIUM CITRATE PH 5.6 & 2 MM DTT' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2003-09-17 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9330 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-2' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-2 _diffrn_source.pdbx_wavelength 0.9330 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XRU _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 30.00 _reflns.d_resolution_high 2.90 _reflns.number_obs 7931 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 34.60 _reflns.B_iso_Wilson_estimate 95.2 _reflns.pdbx_redundancy 10.2 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.00 _reflns_shell.percent_possible_all 99.7 _reflns_shell.Rmerge_I_obs 0.75 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.20 _reflns_shell.pdbx_redundancy ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2XRU _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 7878 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1264925.36 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 29.98 _refine.ls_d_res_high 2.90 _refine.ls_percent_reflns_obs 99.5 _refine.ls_R_factor_obs 0.247 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.247 _refine.ls_R_factor_R_free 0.344 _refine.ls_R_factor_R_free_error 0.017 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 405 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 97.1 _refine.aniso_B[1][1] -14.09 _refine.aniso_B[2][2] -14.09 _refine.aniso_B[3][3] 28.18 _refine.aniso_B[1][2] 10.41 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.33917 _refine.solvent_model_param_bsol 73.1596 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 2XRU _refine_analyze.Luzzati_coordinate_error_obs 0.49 _refine_analyze.Luzzati_sigma_a_obs 0.64 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.53 _refine_analyze.Luzzati_sigma_a_free 0.89 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2082 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2118 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 29.98 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.1 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 23.4 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.69 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 13.51 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 20.96 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 17.54 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 24.85 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.90 _refine_ls_shell.d_res_low 3.08 _refine_ls_shell.number_reflns_R_work 1206 _refine_ls_shell.R_factor_R_work 0.476 _refine_ls_shell.percent_reflns_obs 98.9 _refine_ls_shell.R_factor_R_free 0.628 _refine_ls_shell.R_factor_R_free_error 0.082 _refine_ls_shell.percent_reflns_R_free 4.7 _refine_ls_shell.number_reflns_R_free 59 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP # _struct.entry_id 2XRU _struct.title 'AURORA-A T288E COMPLEXED WITH PHA-828300' _struct.pdbx_descriptor 'SERINE/THREONINE-PROTEIN KINASE 6 (E.C.2.7.11.1)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XRU _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'NUCLEOTIDE-BINDING, KINASE, CELL CYCLE, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 43 ? GLY A 50 ? LYS A 166 GLY A 173 1 ? 8 HELX_P HELX_P2 2 VAL A 51 ? HIS A 64 ? VAL A 174 HIS A 187 1 ? 14 HELX_P HELX_P3 3 THR A 94 ? SER A 103 ? THR A 217 SER A 226 1 ? 10 HELX_P HELX_P4 4 ASP A 106 ? LYS A 127 ? ASP A 229 LYS A 250 1 ? 22 HELX_P HELX_P5 5 LYS A 135 ? GLU A 137 ? LYS A 258 GLU A 260 5 ? 3 HELX_P HELX_P6 6 THR A 169 ? LEU A 173 ? THR A 292 LEU A 296 5 ? 5 HELX_P HELX_P7 7 PRO A 174 ? GLU A 179 ? PRO A 297 GLU A 302 1 ? 6 HELX_P HELX_P8 8 LYS A 186 ? GLY A 202 ? LYS A 309 GLY A 325 1 ? 17 HELX_P HELX_P9 9 THR A 210 ? ARG A 220 ? THR A 333 ARG A 343 1 ? 11 HELX_P HELX_P10 10 THR A 230 ? LEU A 241 ? THR A 353 LEU A 364 1 ? 12 HELX_P HELX_P11 11 ASN A 244 ? ARG A 248 ? ASN A 367 ARG A 371 5 ? 5 HELX_P HELX_P12 12 MET A 250 ? HIS A 257 ? MET A 373 HIS A 380 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 5 ? AB ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AB 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 PHE A 10 ? LYS A 18 ? PHE A 133 LYS A 141 AA 2 ASN A 23 ? GLU A 29 ? ASN A 146 GLU A 152 AA 3 PHE A 34 ? PHE A 42 ? PHE A 157 PHE A 165 AA 4 ARG A 82 ? LEU A 87 ? ARG A 205 LEU A 210 AA 5 PHE A 77 ? HIS A 78 ? PHE A 200 HIS A 201 AB 1 LEU A 139 ? LEU A 141 ? LEU A 262 LEU A 264 AB 2 LEU A 147 ? ILE A 149 ? LEU A 270 ILE A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N LEU A 16 ? N LEU A 139 O VAL A 24 ? O VAL A 147 AA 2 3 N GLU A 29 ? N GLU A 152 O PHE A 34 ? O PHE A 157 AA 3 4 N LEU A 41 ? N LEU A 164 O VAL A 83 ? O VAL A 206 AA 4 5 N TYR A 84 ? N TYR A 207 O PHE A 77 ? O PHE A 200 AB 1 2 N LEU A 140 ? N LEU A 263 O LYS A 148 ? O LYS A 271 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'BINDING SITE FOR RESIDUE 400 A 1389' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 ARG A 14 ? ARG A 137 . ? 1_555 ? 2 AC1 18 LEU A 16 ? LEU A 139 . ? 1_555 ? 3 AC1 18 ALA A 37 ? ALA A 160 . ? 1_555 ? 4 AC1 18 LYS A 39 ? LYS A 162 . ? 1_555 ? 5 AC1 18 LEU A 71 ? LEU A 194 . ? 1_555 ? 6 AC1 18 LEU A 87 ? LEU A 210 . ? 1_555 ? 7 AC1 18 GLU A 88 ? GLU A 211 . ? 1_555 ? 8 AC1 18 TYR A 89 ? TYR A 212 . ? 1_555 ? 9 AC1 18 ALA A 90 ? ALA A 213 . ? 1_555 ? 10 AC1 18 PRO A 91 ? PRO A 214 . ? 1_555 ? 11 AC1 18 LEU A 92 ? LEU A 215 . ? 1_555 ? 12 AC1 18 GLY A 93 ? GLY A 216 . ? 1_555 ? 13 AC1 18 LYS A 101 ? LYS A 224 . ? 1_555 ? 14 AC1 18 GLU A 137 ? GLU A 260 . ? 1_555 ? 15 AC1 18 ASN A 138 ? ASN A 261 . ? 1_555 ? 16 AC1 18 LEU A 140 ? LEU A 263 . ? 1_555 ? 17 AC1 18 ASP A 151 ? ASP A 274 . ? 1_555 ? 18 AC1 18 HIS A 243 ? HIS A 366 . ? 8_565 ? # _database_PDB_matrix.entry_id 2XRU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XRU _atom_sites.fract_transf_matrix[1][1] 0.012126 _atom_sites.fract_transf_matrix[1][2] 0.007001 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014002 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006044 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 124 ? ? ? A . n A 1 2 PRO 2 125 ? ? ? A . n A 1 3 ARG 3 126 126 ARG ARG A . n A 1 4 GLN 4 127 127 GLN GLN A . n A 1 5 TRP 5 128 128 TRP TRP A . n A 1 6 ALA 6 129 129 ALA ALA A . n A 1 7 LEU 7 130 130 LEU LEU A . n A 1 8 GLU 8 131 131 GLU GLU A . n A 1 9 ASP 9 132 132 ASP ASP A . n A 1 10 PHE 10 133 133 PHE PHE A . n A 1 11 GLU 11 134 134 GLU GLU A . n A 1 12 ILE 12 135 135 ILE ILE A . n A 1 13 GLY 13 136 136 GLY GLY A . n A 1 14 ARG 14 137 137 ARG ARG A . n A 1 15 PRO 15 138 138 PRO PRO A . n A 1 16 LEU 16 139 139 LEU LEU A . n A 1 17 GLY 17 140 140 GLY GLY A . n A 1 18 LYS 18 141 141 LYS LYS A . n A 1 19 GLY 19 142 142 GLY GLY A . n A 1 20 LYS 20 143 143 LYS LYS A . n A 1 21 PHE 21 144 144 PHE PHE A . n A 1 22 GLY 22 145 145 GLY GLY A . n A 1 23 ASN 23 146 146 ASN ASN A . n A 1 24 VAL 24 147 147 VAL VAL A . n A 1 25 TYR 25 148 148 TYR TYR A . n A 1 26 LEU 26 149 149 LEU LEU A . n A 1 27 ALA 27 150 150 ALA ALA A . n A 1 28 ARG 28 151 151 ARG ARG A . n A 1 29 GLU 29 152 152 GLU GLU A . n A 1 30 LYS 30 153 153 LYS LYS A . n A 1 31 GLN 31 154 154 GLN GLN A . n A 1 32 SER 32 155 155 SER SER A . n A 1 33 LYS 33 156 156 LYS LYS A . n A 1 34 PHE 34 157 157 PHE PHE A . n A 1 35 ILE 35 158 158 ILE ILE A . n A 1 36 LEU 36 159 159 LEU LEU A . n A 1 37 ALA 37 160 160 ALA ALA A . n A 1 38 LEU 38 161 161 LEU LEU A . n A 1 39 LYS 39 162 162 LYS LYS A . n A 1 40 VAL 40 163 163 VAL VAL A . n A 1 41 LEU 41 164 164 LEU LEU A . n A 1 42 PHE 42 165 165 PHE PHE A . n A 1 43 LYS 43 166 166 LYS LYS A . n A 1 44 ALA 44 167 167 ALA ALA A . n A 1 45 GLN 45 168 168 GLN GLN A . n A 1 46 LEU 46 169 169 LEU LEU A . n A 1 47 GLU 47 170 170 GLU GLU A . n A 1 48 LYS 48 171 171 LYS LYS A . n A 1 49 ALA 49 172 172 ALA ALA A . n A 1 50 GLY 50 173 173 GLY GLY A . n A 1 51 VAL 51 174 174 VAL VAL A . n A 1 52 GLU 52 175 175 GLU GLU A . n A 1 53 HIS 53 176 176 HIS HIS A . n A 1 54 GLN 54 177 177 GLN GLN A . n A 1 55 LEU 55 178 178 LEU LEU A . n A 1 56 ARG 56 179 179 ARG ARG A . n A 1 57 ARG 57 180 180 ARG ARG A . n A 1 58 GLU 58 181 181 GLU GLU A . n A 1 59 VAL 59 182 182 VAL VAL A . n A 1 60 GLU 60 183 183 GLU GLU A . n A 1 61 ILE 61 184 184 ILE ILE A . n A 1 62 GLN 62 185 185 GLN GLN A . n A 1 63 SER 63 186 186 SER SER A . n A 1 64 HIS 64 187 187 HIS HIS A . n A 1 65 LEU 65 188 188 LEU LEU A . n A 1 66 ARG 66 189 189 ARG ARG A . n A 1 67 HIS 67 190 190 HIS HIS A . n A 1 68 PRO 68 191 191 PRO PRO A . n A 1 69 ASN 69 192 192 ASN ASN A . n A 1 70 ILE 70 193 193 ILE ILE A . n A 1 71 LEU 71 194 194 LEU LEU A . n A 1 72 ARG 72 195 195 ARG ARG A . n A 1 73 LEU 73 196 196 LEU LEU A . n A 1 74 TYR 74 197 197 TYR TYR A . n A 1 75 GLY 75 198 198 GLY GLY A . n A 1 76 TYR 76 199 199 TYR TYR A . n A 1 77 PHE 77 200 200 PHE PHE A . n A 1 78 HIS 78 201 201 HIS HIS A . n A 1 79 ASP 79 202 202 ASP ASP A . n A 1 80 ALA 80 203 203 ALA ALA A . n A 1 81 THR 81 204 204 THR THR A . n A 1 82 ARG 82 205 205 ARG ARG A . n A 1 83 VAL 83 206 206 VAL VAL A . n A 1 84 TYR 84 207 207 TYR TYR A . n A 1 85 LEU 85 208 208 LEU LEU A . n A 1 86 ILE 86 209 209 ILE ILE A . n A 1 87 LEU 87 210 210 LEU LEU A . n A 1 88 GLU 88 211 211 GLU GLU A . n A 1 89 TYR 89 212 212 TYR TYR A . n A 1 90 ALA 90 213 213 ALA ALA A . n A 1 91 PRO 91 214 214 PRO PRO A . n A 1 92 LEU 92 215 215 LEU LEU A . n A 1 93 GLY 93 216 216 GLY GLY A . n A 1 94 THR 94 217 217 THR THR A . n A 1 95 VAL 95 218 218 VAL VAL A . n A 1 96 TYR 96 219 219 TYR TYR A . n A 1 97 ARG 97 220 220 ARG ARG A . n A 1 98 GLU 98 221 221 GLU GLU A . n A 1 99 LEU 99 222 222 LEU LEU A . n A 1 100 GLN 100 223 223 GLN GLN A . n A 1 101 LYS 101 224 224 LYS LYS A . n A 1 102 LEU 102 225 225 LEU LEU A . n A 1 103 SER 103 226 226 SER SER A . n A 1 104 LYS 104 227 227 LYS LYS A . n A 1 105 PHE 105 228 228 PHE PHE A . n A 1 106 ASP 106 229 229 ASP ASP A . n A 1 107 GLU 107 230 230 GLU GLU A . n A 1 108 GLN 108 231 231 GLN GLN A . n A 1 109 ARG 109 232 232 ARG ARG A . n A 1 110 THR 110 233 233 THR THR A . n A 1 111 ALA 111 234 234 ALA ALA A . n A 1 112 THR 112 235 235 THR THR A . n A 1 113 TYR 113 236 236 TYR TYR A . n A 1 114 ILE 114 237 237 ILE ILE A . n A 1 115 THR 115 238 238 THR THR A . n A 1 116 GLU 116 239 239 GLU GLU A . n A 1 117 LEU 117 240 240 LEU LEU A . n A 1 118 ALA 118 241 241 ALA ALA A . n A 1 119 ASN 119 242 242 ASN ASN A . n A 1 120 ALA 120 243 243 ALA ALA A . n A 1 121 LEU 121 244 244 LEU LEU A . n A 1 122 SER 122 245 245 SER SER A . n A 1 123 TYR 123 246 246 TYR TYR A . n A 1 124 CYS 124 247 247 CYS CYS A . n A 1 125 HIS 125 248 248 HIS HIS A . n A 1 126 SER 126 249 249 SER SER A . n A 1 127 LYS 127 250 250 LYS LYS A . n A 1 128 ARG 128 251 251 ARG ARG A . n A 1 129 VAL 129 252 252 VAL VAL A . n A 1 130 ILE 130 253 253 ILE ILE A . n A 1 131 HIS 131 254 254 HIS HIS A . n A 1 132 ARG 132 255 255 ARG ARG A . n A 1 133 ASP 133 256 256 ASP ASP A . n A 1 134 ILE 134 257 257 ILE ILE A . n A 1 135 LYS 135 258 258 LYS LYS A . n A 1 136 PRO 136 259 259 PRO PRO A . n A 1 137 GLU 137 260 260 GLU GLU A . n A 1 138 ASN 138 261 261 ASN ASN A . n A 1 139 LEU 139 262 262 LEU LEU A . n A 1 140 LEU 140 263 263 LEU LEU A . n A 1 141 LEU 141 264 264 LEU LEU A . n A 1 142 GLY 142 265 265 GLY GLY A . n A 1 143 SER 143 266 266 SER SER A . n A 1 144 ALA 144 267 267 ALA ALA A . n A 1 145 GLY 145 268 268 GLY GLY A . n A 1 146 GLU 146 269 269 GLU GLU A . n A 1 147 LEU 147 270 270 LEU LEU A . n A 1 148 LYS 148 271 271 LYS LYS A . n A 1 149 ILE 149 272 272 ILE ILE A . n A 1 150 ALA 150 273 273 ALA ALA A . n A 1 151 ASP 151 274 274 ASP ASP A . n A 1 152 PHE 152 275 275 PHE PHE A . n A 1 153 GLY 153 276 276 GLY GLY A . n A 1 154 TRP 154 277 277 TRP TRP A . n A 1 155 SER 155 278 278 SER SER A . n A 1 156 VAL 156 279 279 VAL VAL A . n A 1 157 HIS 157 280 ? ? ? A . n A 1 158 ALA 158 281 ? ? ? A . n A 1 159 PRO 159 282 ? ? ? A . n A 1 160 SER 160 283 ? ? ? A . n A 1 161 SER 161 284 ? ? ? A . n A 1 162 ARG 162 285 ? ? ? A . n A 1 163 ARG 163 286 ? ? ? A . n A 1 164 THR 164 287 ? ? ? A . n A 1 165 GLU 165 288 ? ? ? A . n A 1 166 LEU 166 289 ? ? ? A . n A 1 167 CYS 167 290 290 CYS CYS A . n A 1 168 GLY 168 291 291 GLY GLY A . n A 1 169 THR 169 292 292 THR THR A . n A 1 170 LEU 170 293 293 LEU LEU A . n A 1 171 ASP 171 294 294 ASP ASP A . n A 1 172 TYR 172 295 295 TYR TYR A . n A 1 173 LEU 173 296 296 LEU LEU A . n A 1 174 PRO 174 297 297 PRO PRO A . n A 1 175 PRO 175 298 298 PRO PRO A . n A 1 176 GLU 176 299 299 GLU GLU A . n A 1 177 MET 177 300 300 MET MET A . n A 1 178 ILE 178 301 301 ILE ILE A . n A 1 179 GLU 179 302 302 GLU GLU A . n A 1 180 GLY 180 303 303 GLY GLY A . n A 1 181 ARG 181 304 304 ARG ARG A . n A 1 182 MET 182 305 305 MET MET A . n A 1 183 HIS 183 306 306 HIS HIS A . n A 1 184 ASP 184 307 307 ASP ASP A . n A 1 185 GLU 185 308 308 GLU GLU A . n A 1 186 LYS 186 309 309 LYS LYS A . n A 1 187 VAL 187 310 310 VAL VAL A . n A 1 188 ASP 188 311 311 ASP ASP A . n A 1 189 LEU 189 312 312 LEU LEU A . n A 1 190 TRP 190 313 313 TRP TRP A . n A 1 191 SER 191 314 314 SER SER A . n A 1 192 LEU 192 315 315 LEU LEU A . n A 1 193 GLY 193 316 316 GLY GLY A . n A 1 194 VAL 194 317 317 VAL VAL A . n A 1 195 LEU 195 318 318 LEU LEU A . n A 1 196 CYS 196 319 319 CYS CYS A . n A 1 197 TYR 197 320 320 TYR TYR A . n A 1 198 GLU 198 321 321 GLU GLU A . n A 1 199 PHE 199 322 322 PHE PHE A . n A 1 200 LEU 200 323 323 LEU LEU A . n A 1 201 VAL 201 324 324 VAL VAL A . n A 1 202 GLY 202 325 325 GLY GLY A . n A 1 203 LYS 203 326 326 LYS LYS A . n A 1 204 PRO 204 327 327 PRO PRO A . n A 1 205 PRO 205 328 328 PRO PRO A . n A 1 206 PHE 206 329 329 PHE PHE A . n A 1 207 GLU 207 330 330 GLU GLU A . n A 1 208 ALA 208 331 331 ALA ALA A . n A 1 209 ASN 209 332 332 ASN ASN A . n A 1 210 THR 210 333 333 THR THR A . n A 1 211 TYR 211 334 334 TYR TYR A . n A 1 212 GLN 212 335 335 GLN GLN A . n A 1 213 GLU 213 336 336 GLU GLU A . n A 1 214 THR 214 337 337 THR THR A . n A 1 215 TYR 215 338 338 TYR TYR A . n A 1 216 LYS 216 339 339 LYS LYS A . n A 1 217 ARG 217 340 340 ARG ARG A . n A 1 218 ILE 218 341 341 ILE ILE A . n A 1 219 SER 219 342 342 SER SER A . n A 1 220 ARG 220 343 343 ARG ARG A . n A 1 221 VAL 221 344 344 VAL VAL A . n A 1 222 GLU 222 345 345 GLU GLU A . n A 1 223 PHE 223 346 346 PHE PHE A . n A 1 224 THR 224 347 347 THR THR A . n A 1 225 PHE 225 348 348 PHE PHE A . n A 1 226 PRO 226 349 349 PRO PRO A . n A 1 227 ASP 227 350 350 ASP ASP A . n A 1 228 PHE 228 351 351 PHE PHE A . n A 1 229 VAL 229 352 352 VAL VAL A . n A 1 230 THR 230 353 353 THR THR A . n A 1 231 GLU 231 354 354 GLU GLU A . n A 1 232 GLY 232 355 355 GLY GLY A . n A 1 233 ALA 233 356 356 ALA ALA A . n A 1 234 ARG 234 357 357 ARG ARG A . n A 1 235 ASP 235 358 358 ASP ASP A . n A 1 236 LEU 236 359 359 LEU LEU A . n A 1 237 ILE 237 360 360 ILE ILE A . n A 1 238 SER 238 361 361 SER SER A . n A 1 239 ARG 239 362 362 ARG ARG A . n A 1 240 LEU 240 363 363 LEU LEU A . n A 1 241 LEU 241 364 364 LEU LEU A . n A 1 242 LYS 242 365 365 LYS LYS A . n A 1 243 HIS 243 366 366 HIS HIS A . n A 1 244 ASN 244 367 367 ASN ASN A . n A 1 245 PRO 245 368 368 PRO PRO A . n A 1 246 SER 246 369 369 SER SER A . n A 1 247 GLN 247 370 370 GLN GLN A . n A 1 248 ARG 248 371 371 ARG ARG A . n A 1 249 PRO 249 372 372 PRO PRO A . n A 1 250 MET 250 373 373 MET MET A . n A 1 251 LEU 251 374 374 LEU LEU A . n A 1 252 ARG 252 375 375 ARG ARG A . n A 1 253 GLU 253 376 376 GLU GLU A . n A 1 254 VAL 254 377 377 VAL VAL A . n A 1 255 LEU 255 378 378 LEU LEU A . n A 1 256 GLU 256 379 379 GLU GLU A . n A 1 257 HIS 257 380 380 HIS HIS A . n A 1 258 PRO 258 381 381 PRO PRO A . n A 1 259 TRP 259 382 382 TRP TRP A . n A 1 260 ILE 260 383 383 ILE ILE A . n A 1 261 THR 261 384 384 THR THR A . n A 1 262 ALA 262 385 385 ALA ALA A . n A 1 263 ASN 263 386 386 ASN ASN A . n A 1 264 SER 264 387 387 SER SER A . n A 1 265 SER 265 388 388 SER SER A . n A 1 266 LYS 266 389 389 LYS LYS A . n A 1 267 PRO 267 390 ? ? ? A . n A 1 268 SER 268 391 ? ? ? A . n A 1 269 ASN 269 392 ? ? ? A . n A 1 270 CYS 270 393 ? ? ? A . n A 1 271 GLN 271 394 ? ? ? A . n A 1 272 ASN 272 395 ? ? ? A . n A 1 273 LYS 273 396 ? ? ? A . n A 1 274 GLU 274 397 ? ? ? A . n A 1 275 SER 275 398 ? ? ? A . n A 1 276 ALA 276 399 ? ? ? A . n A 1 277 SER 277 400 ? ? ? A . n A 1 278 LYS 278 401 ? ? ? A . n A 1 279 GLN 279 402 ? ? ? A . n A 1 280 SER 280 403 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 400 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1389 _pdbx_nonpoly_scheme.auth_seq_num 1389 _pdbx_nonpoly_scheme.pdb_mon_id 400 _pdbx_nonpoly_scheme.auth_mon_id 400 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-09-29 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' pdbx_database_proc 3 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line' 2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement . ? 1 DENZO 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 MOLREP phasing . ? 4 # _pdbx_entry_details.entry_id 2XRU _pdbx_entry_details.compound_details 'ENGINEERED RESIDUE IN CHAIN A, THR 288 TO GLU' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NZ _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 LYS _pdbx_validate_symm_contact.auth_seq_id_1 339 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 339 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 10_664 _pdbx_validate_symm_contact.dist 1.85 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ALA _pdbx_validate_rmsd_angle.auth_seq_id_1 213 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 214 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 214 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 128.75 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.45 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 127 ? ? 40.80 91.41 2 1 LEU A 130 ? ? -49.93 7.02 3 1 LYS A 171 ? ? -49.99 -9.86 4 1 GLN A 185 ? ? -58.03 -70.55 5 1 ASP A 202 ? ? -89.45 -135.86 6 1 ILE A 209 ? ? -48.36 89.23 7 1 SER A 226 ? ? 75.03 -73.25 8 1 ARG A 251 ? ? 84.56 -20.03 9 1 ARG A 255 ? ? 72.75 -79.27 10 1 ASP A 256 ? ? -65.45 32.69 11 1 ASP A 274 ? ? 69.40 129.42 12 1 PHE A 275 ? ? -125.84 -55.47 13 1 TRP A 277 ? ? 149.51 21.10 14 1 ASP A 294 ? ? -30.79 -36.85 15 1 GLU A 299 ? ? -41.82 -78.93 16 1 MET A 300 ? ? -29.38 -73.51 17 1 ARG A 304 ? ? -46.63 150.80 18 1 ASP A 307 ? ? -132.22 -115.31 19 1 GLU A 330 ? ? -24.40 128.13 20 1 VAL A 344 ? ? 71.35 39.95 21 1 HIS A 380 ? ? -30.01 131.74 22 1 ASN A 386 ? ? -141.99 -18.43 23 1 SER A 387 ? ? -74.58 -133.11 24 1 SER A 388 ? ? -175.49 -45.73 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 389 ? CA ? A LYS 266 CA 2 1 Y 1 A LYS 389 ? C ? A LYS 266 C 3 1 Y 1 A LYS 389 ? O ? A LYS 266 O 4 1 Y 1 A LYS 389 ? CB ? A LYS 266 CB 5 1 Y 1 A LYS 389 ? CG ? A LYS 266 CG 6 1 Y 1 A LYS 389 ? CD ? A LYS 266 CD 7 1 Y 1 A LYS 389 ? CE ? A LYS 266 CE 8 1 Y 1 A LYS 389 ? NZ ? A LYS 266 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 124 ? A GLY 1 2 1 Y 1 A PRO 125 ? A PRO 2 3 1 Y 1 A HIS 280 ? A HIS 157 4 1 Y 1 A ALA 281 ? A ALA 158 5 1 Y 1 A PRO 282 ? A PRO 159 6 1 Y 1 A SER 283 ? A SER 160 7 1 Y 1 A SER 284 ? A SER 161 8 1 Y 1 A ARG 285 ? A ARG 162 9 1 Y 1 A ARG 286 ? A ARG 163 10 1 Y 1 A THR 287 ? A THR 164 11 1 Y 1 A GLU 288 ? A GLU 165 12 1 Y 1 A LEU 289 ? A LEU 166 13 1 Y 1 A PRO 390 ? A PRO 267 14 1 Y 1 A SER 391 ? A SER 268 15 1 Y 1 A ASN 392 ? A ASN 269 16 1 Y 1 A CYS 393 ? A CYS 270 17 1 Y 1 A GLN 394 ? A GLN 271 18 1 Y 1 A ASN 395 ? A ASN 272 19 1 Y 1 A LYS 396 ? A LYS 273 20 1 Y 1 A GLU 397 ? A GLU 274 21 1 Y 1 A SER 398 ? A SER 275 22 1 Y 1 A ALA 399 ? A ALA 276 23 1 Y 1 A SER 400 ? A SER 277 24 1 Y 1 A LYS 401 ? A LYS 278 25 1 Y 1 A GLN 402 ? A GLN 279 26 1 Y 1 A SER 403 ? A SER 280 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '3-({[4-(4-METHYLPIPERAZIN-1-YL)PHENYL]CARBONYL}AMINO)-N-[(1R)-1-PHENYLPROPYL]-1H-THIENO[3,2-C]PYRAZOLE-5-CARBOXAMIDE' _pdbx_entity_nonpoly.comp_id 400 #