data_2YHH # _entry.id 2YHH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2YHH PDBE EBI-48171 WWPDB D_1290048171 BMRB 17625 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2Y1S unspecified 'MICROVIRIN LECTIN' BMRB 17625 unspecified . # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YHH _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2011-05-02 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hussan, S.' 1 'Bewley, C.A.' 2 'Clore, G.M.' 3 'Gustchina, E.' 4 'Ghirlando, R.' 5 # _citation.id primary _citation.title ;Solution Structure of the Monovalent Lectin Microvirin in Complex with Man(Alpha)(1-2)Man Provides a Basis for Anti-HIV Activity with Low Toxicity. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 20788 _citation.page_last ? _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21471192 _citation.pdbx_database_id_DOI 10.1074/JBC.M111.232678 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shahzad-Ul-Hussan, S.' 1 ? primary 'Gustchina, E.' 2 ? primary 'Ghirlando, R.' 3 ? primary 'Clore, G.M.' 4 ? primary 'Bewley, C.A.' 5 ? # _cell.entry_id 2YHH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2YHH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MANNAN-BINDING LECTIN' 12186.159 1 ? ? ? ? 2 branched man 'alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose' 342.297 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'MICROVIRIN, MVN PROTEIN' 2 2alpha-alpha-mannobiose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MPNFSHTCSSINYDPDSTILSAECQARDGEWLPTELRLSDHIGNIDGELQFGDQNFQETCQDCRLEFGDGEQSVWLVCTC QTMDGEWKSTQILLDSQIDNNDSQLEIG ; _entity_poly.pdbx_seq_one_letter_code_can ;MPNFSHTCSSINYDPDSTILSAECQARDGEWLPTELRLSDHIGNIDGELQFGDQNFQETCQDCRLEFGDGEQSVWLVCTC QTMDGEWKSTQILLDSQIDNNDSQLEIG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PRO n 1 3 ASN n 1 4 PHE n 1 5 SER n 1 6 HIS n 1 7 THR n 1 8 CYS n 1 9 SER n 1 10 SER n 1 11 ILE n 1 12 ASN n 1 13 TYR n 1 14 ASP n 1 15 PRO n 1 16 ASP n 1 17 SER n 1 18 THR n 1 19 ILE n 1 20 LEU n 1 21 SER n 1 22 ALA n 1 23 GLU n 1 24 CYS n 1 25 GLN n 1 26 ALA n 1 27 ARG n 1 28 ASP n 1 29 GLY n 1 30 GLU n 1 31 TRP n 1 32 LEU n 1 33 PRO n 1 34 THR n 1 35 GLU n 1 36 LEU n 1 37 ARG n 1 38 LEU n 1 39 SER n 1 40 ASP n 1 41 HIS n 1 42 ILE n 1 43 GLY n 1 44 ASN n 1 45 ILE n 1 46 ASP n 1 47 GLY n 1 48 GLU n 1 49 LEU n 1 50 GLN n 1 51 PHE n 1 52 GLY n 1 53 ASP n 1 54 GLN n 1 55 ASN n 1 56 PHE n 1 57 GLN n 1 58 GLU n 1 59 THR n 1 60 CYS n 1 61 GLN n 1 62 ASP n 1 63 CYS n 1 64 ARG n 1 65 LEU n 1 66 GLU n 1 67 PHE n 1 68 GLY n 1 69 ASP n 1 70 GLY n 1 71 GLU n 1 72 GLN n 1 73 SER n 1 74 VAL n 1 75 TRP n 1 76 LEU n 1 77 VAL n 1 78 CYS n 1 79 THR n 1 80 CYS n 1 81 GLN n 1 82 THR n 1 83 MET n 1 84 ASP n 1 85 GLY n 1 86 GLU n 1 87 TRP n 1 88 LYS n 1 89 SER n 1 90 THR n 1 91 GLN n 1 92 ILE n 1 93 LEU n 1 94 LEU n 1 95 ASP n 1 96 SER n 1 97 GLN n 1 98 ILE n 1 99 ASP n 1 100 ASN n 1 101 ASN n 1 102 ASP n 1 103 SER n 1 104 GLN n 1 105 LEU n 1 106 GLU n 1 107 ILE n 1 108 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'MICROCYSTIS AERUGINOSA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1126 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector PET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2MDE2_MICAE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q2MDE2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YHH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2MDE2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2YHH _struct_ref_seq_dif.mon_id ARG _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 64 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q2MDE2 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 64 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 64 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 HSQC 1 2 1 HNCACB 1 3 1 HNCO 1 4 1 NOESY 1 5 1 HNHA 1 6 1 HNCG 1 7 1 HOHAHA 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '10% WATER/90% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 2YHH _pdbx_nmr_refine.method 'TORSION ANGLE, SIMULATED ANNEALING' _pdbx_nmr_refine.details ;THE STRUCTURE ENSEMBLE OF 1:1 MVN:MAN ALPHA(1-2)MAN WAS DETERMINED BY CONJOINED RIGID BODY/TORSION ANGLE-SIMULATED ANNEALING (XPLOR-NIH), STARTING WITH COORDINATES 2Y1S. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2YHH _pdbx_nmr_details.text NONE # _pdbx_nmr_ensemble.entry_id 2YHH _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 2 _pdbx_nmr_ensemble.conformer_selection_criteria 'LEAST RESTRAINT VIOLATION' # _pdbx_nmr_representative.entry_id 2YHH _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement Xplor-NIH ? BRUNGER 1 'structure solution' X-PLOR ? ? 2 # _exptl.entry_id 2YHH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YHH _struct.title 'Microvirin:mannobiose complex' _struct.pdbx_descriptor 'MANNAN-BINDING LECTIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YHH _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'SUGAR BINDING PROTEIN, CYANOVIRIN FAMILY, CELL-CELL ATTACHMENT, ANTI-HIV PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 3 ? THR A 7 ? ASN A 3 THR A 7 1 ? 5 HELX_P HELX_P2 2 PHE A 56 ? GLU A 58 ? PHE A 56 GLU A 58 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 8 A CYS 24 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 60 A CYS 80 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf3 disulf ? ? A CYS 63 SG ? ? ? 1_555 A CYS 78 SG ? ? A CYS 63 A CYS 78 1_555 ? ? ? ? ? ? ? 2.027 ? ? covale1 covale one ? B MAN . O2 ? ? ? 1_555 B MAN . C1 ? ? B MAN 1 B MAN 2 1_555 ? ? ? ? ? ? ? 1.455 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 3 ? AB ? 2 ? AC ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AB 1 2 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 CYS A 8 ? ASP A 14 ? CYS A 8 ASP A 14 AA 2 ILE A 19 ? GLN A 25 ? ILE A 19 GLN A 25 AA 3 TRP A 31 ? ARG A 37 ? TRP A 31 ARG A 37 AB 1 ILE A 42 ? ILE A 45 ? ILE A 42 ILE A 45 AB 2 GLU A 48 ? PHE A 51 ? GLU A 48 PHE A 51 AC 1 CYS A 60 ? PHE A 67 ? CYS A 60 PHE A 67 AC 2 VAL A 74 ? GLN A 81 ? VAL A 74 GLN A 81 AC 3 TRP A 87 ? ILE A 92 ? TRP A 87 ILE A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ASP A 14 ? N ASP A 14 O ILE A 19 ? O ILE A 19 AA 2 3 N CYS A 24 ? N CYS A 24 O LEU A 32 ? O LEU A 32 AB 1 2 N ILE A 45 ? N ILE A 45 O GLU A 48 ? O GLU A 48 AC 1 2 N GLU A 66 ? N GLU A 66 O TRP A 75 ? O TRP A 75 AC 2 3 N CYS A 80 ? N CYS A 80 O LYS A 88 ? O LYS A 88 # _database_PDB_matrix.entry_id 2YHH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YHH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 GLY 108 108 108 GLY GLY A . n # _pdbx_molecule_features.prd_id PRD_900111 _pdbx_molecule_features.name 2alpha-alpha-mannobiose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Metabolism _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900111 _pdbx_molecule.asym_id B # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-15 2 'Structure model' 1 1 2013-01-09 3 'Structure model' 1 2 2019-07-03 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' Other 4 2 'Structure model' 'Version format compliance' 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Derived calculations' 7 3 'Structure model' Other 8 4 'Structure model' Advisory 9 4 'Structure model' 'Atomic model' 10 4 'Structure model' 'Data collection' 11 4 'Structure model' 'Derived calculations' 12 4 'Structure model' Other 13 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_proc 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_conn 5 4 'Structure model' atom_site 6 4 'Structure model' chem_comp 7 4 'Structure model' entity 8 4 'Structure model' entity_name_com 9 4 'Structure model' pdbx_branch_scheme 10 4 'Structure model' pdbx_chem_comp_identifier 11 4 'Structure model' pdbx_database_status 12 4 'Structure model' pdbx_entity_branch 13 4 'Structure model' pdbx_entity_branch_descriptor 14 4 'Structure model' pdbx_entity_branch_link 15 4 'Structure model' pdbx_entity_branch_list 16 4 'Structure model' pdbx_entity_nonpoly 17 4 'Structure model' pdbx_molecule_features 18 4 'Structure model' pdbx_nmr_spectrometer 19 4 'Structure model' pdbx_nonpoly_scheme 20 4 'Structure model' pdbx_struct_assembly_gen 21 4 'Structure model' pdbx_validate_close_contact 22 4 'Structure model' struct_asym 23 4 'Structure model' struct_conn 24 4 'Structure model' struct_site 25 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.date_of_cs_release' 2 3 'Structure model' '_pdbx_database_status.recvd_author_approval' 3 3 'Structure model' '_pdbx_database_status.status_code_cs' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_atom_site.auth_asym_id' 7 4 'Structure model' '_atom_site.auth_seq_id' 8 4 'Structure model' '_atom_site.label_asym_id' 9 4 'Structure model' '_chem_comp.name' 10 4 'Structure model' '_chem_comp.type' 11 4 'Structure model' '_entity.formula_weight' 12 4 'Structure model' '_entity.pdbx_description' 13 4 'Structure model' '_entity.pdbx_number_of_molecules' 14 4 'Structure model' '_entity.type' 15 4 'Structure model' '_pdbx_database_status.status_code_mr' 16 4 'Structure model' '_pdbx_nmr_spectrometer.model' 17 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_1' 19 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 20 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 21 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH11 A ARG 37 ? ? HG A SER 39 ? ? 1.35 2 1 H A ALA 26 ? ? O A GLU 30 ? ? 1.58 3 1 OD1 A ASP 28 ? ? H A GLU 30 ? ? 1.60 4 2 HH11 A ARG 37 ? ? HG A SER 39 ? ? 1.35 5 2 H A ALA 26 ? ? O A GLU 30 ? ? 1.58 6 2 OD1 A ASP 28 ? ? H A GLU 30 ? ? 1.60 7 2 O2 B MAN 1 ? ? O5 B MAN 2 ? ? 2.12 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A PHE 56 ? ? CA A PHE 56 ? ? C A PHE 56 ? ? 97.14 110.40 -13.26 2.00 N 2 1 CB A PHE 56 ? ? CG A PHE 56 ? ? CD2 A PHE 56 ? ? 113.71 120.80 -7.09 0.70 N 3 1 CB A PHE 56 ? ? CG A PHE 56 ? ? CD1 A PHE 56 ? ? 127.33 120.80 6.53 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -15.94 150.65 2 1 SER A 5 ? ? -76.31 -86.44 3 1 SER A 10 ? ? 70.92 56.62 4 1 SER A 39 ? ? -38.93 -27.74 5 1 ASN A 55 ? ? 68.33 78.53 6 1 GLU A 71 ? ? -66.67 4.66 7 1 SER A 96 ? ? 177.96 -119.09 8 1 GLN A 97 ? ? -78.08 34.92 9 2 PRO A 2 ? ? -15.94 150.65 10 2 SER A 5 ? ? -76.31 -86.44 11 2 SER A 10 ? ? 70.92 56.62 12 2 SER A 39 ? ? -38.93 -27.74 13 2 ASN A 55 ? ? 68.33 78.53 14 2 GLU A 71 ? ? -66.67 4.66 15 2 SER A 96 ? ? 177.96 -119.09 16 2 GLN A 97 ? ? -78.08 34.92 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 37 ? ? 0.119 'SIDE CHAIN' 2 2 ARG A 37 ? ? 0.119 'SIDE CHAIN' # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 MAN 1 B MAN 1 A MAN 1109 n B 2 MAN 2 B MAN 2 A MAN 1110 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-2DManpa1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a1122h-1a_1-5]/1-1/a2-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][a-D-Manp]{[(2+1)][a-D-Manp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 MAN _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 MAN _pdbx_entity_branch_link.atom_id_2 O2 _pdbx_entity_branch_link.leaving_atom_id_2 HO2 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 MAN 1 n 2 MAN 2 n #