data_2YQI # _entry.id 2YQI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YQI pdb_00002yqi 10.2210/pdb2yqi/pdb RCSB RCSB027006 ? ? WWPDB D_1000027006 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002002696.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2YQI _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qin, X.R.' 1 'Hayahsi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the second HMG-box domain from high mobility group protein B3' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qin, X.R.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'High mobility group protein B3' _entity.formula_weight 8886.069 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG-box domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'High mobility group protein 4, HMG-4, High mobility group protein 2a, HMG-2a' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSK G ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSK G ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002002696.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 ALA n 1 10 PRO n 1 11 LYS n 1 12 ARG n 1 13 PRO n 1 14 PRO n 1 15 SER n 1 16 GLY n 1 17 PHE n 1 18 PHE n 1 19 LEU n 1 20 PHE n 1 21 CYS n 1 22 SER n 1 23 GLU n 1 24 PHE n 1 25 ARG n 1 26 PRO n 1 27 LYS n 1 28 ILE n 1 29 LYS n 1 30 SER n 1 31 THR n 1 32 ASN n 1 33 PRO n 1 34 GLY n 1 35 ILE n 1 36 SER n 1 37 ILE n 1 38 GLY n 1 39 ASP n 1 40 VAL n 1 41 ALA n 1 42 LYS n 1 43 LYS n 1 44 LEU n 1 45 GLY n 1 46 GLU n 1 47 MET n 1 48 TRP n 1 49 ASN n 1 50 ASN n 1 51 LEU n 1 52 ASN n 1 53 ASP n 1 54 SER n 1 55 GLU n 1 56 LYS n 1 57 GLN n 1 58 PRO n 1 59 TYR n 1 60 ILE n 1 61 THR n 1 62 LYS n 1 63 ALA n 1 64 ALA n 1 65 LYS n 1 66 LEU n 1 67 LYS n 1 68 GLU n 1 69 LYS n 1 70 TYR n 1 71 GLU n 1 72 LYS n 1 73 ASP n 1 74 VAL n 1 75 ALA n 1 76 ASP n 1 77 TYR n 1 78 LYS n 1 79 SER n 1 80 LYS n 1 81 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene HMGB3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061030-07 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HMGB3_HUMAN _struct_ref.pdbx_db_accession O15347 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKG _struct_ref.pdbx_align_begin 91 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YQI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O15347 _struct_ref_seq.db_align_beg 91 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 164 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YQI GLY A 1 ? UNP O15347 ? ? 'expression tag' 1 1 1 2YQI SER A 2 ? UNP O15347 ? ? 'expression tag' 2 2 1 2YQI SER A 3 ? UNP O15347 ? ? 'expression tag' 3 3 1 2YQI GLY A 4 ? UNP O15347 ? ? 'expression tag' 4 4 1 2YQI SER A 5 ? UNP O15347 ? ? 'expression tag' 5 5 1 2YQI SER A 6 ? UNP O15347 ? ? 'expression tag' 6 6 1 2YQI GLY A 7 ? UNP O15347 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.68mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YQI _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy,target function' _pdbx_nmr_ensemble.entry_id 2YQI _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YQI # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C varian 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2YQI _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YQI _struct.title 'Solution structure of the second HMG-box domain from high mobility group protein B3' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YQI _struct_keywords.text ;HMG-box domain; High mobility group protein B3; mobility group protein 4; mobility group protein 2a, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? ASN A 32 ? SER A 15 ASN A 32 1 ? 18 HELX_P HELX_P2 2 SER A 36 ? LEU A 51 ? SER A 36 LEU A 51 1 ? 16 HELX_P HELX_P3 3 ASN A 52 ? LYS A 78 ? ASN A 52 LYS A 78 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2YQI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 19 ? ? -37.77 -39.44 2 1 LEU A 51 ? ? -45.74 161.02 3 2 LEU A 51 ? ? -43.84 153.45 4 2 SER A 79 ? ? -96.80 49.36 5 3 LEU A 51 ? ? -47.62 151.33 6 3 LYS A 78 ? ? -99.25 51.90 7 3 SER A 79 ? ? -58.40 79.09 8 4 SER A 6 ? ? -173.78 121.29 9 4 SER A 79 ? ? -42.83 93.43 10 5 ILE A 37 ? ? -34.18 -39.53 11 5 LYS A 72 ? ? -64.99 -70.21 12 5 LYS A 78 ? ? -42.83 92.61 13 6 SER A 2 ? ? -54.99 97.29 14 6 ARG A 12 ? ? -35.85 143.75 15 6 ILE A 37 ? ? -39.25 -38.66 16 7 LEU A 19 ? ? -39.21 -34.84 17 8 ASN A 8 ? ? -34.64 148.78 18 9 ASN A 8 ? ? -99.78 -61.91 19 9 LEU A 19 ? ? -39.28 -37.18 20 9 LEU A 51 ? ? -40.85 161.75 21 10 ARG A 12 ? ? -34.25 135.44 22 10 LEU A 51 ? ? -48.69 154.28 23 10 LYS A 80 ? ? -59.95 108.51 24 11 SER A 6 ? ? 38.83 53.41 25 11 ASN A 8 ? ? 37.91 47.07 26 11 ASP A 73 ? ? -94.14 -65.93 27 12 SER A 3 ? ? -122.73 -55.97 28 12 GLU A 71 ? ? -37.82 -35.36 29 13 LEU A 51 ? ? -41.81 156.34 30 13 SER A 79 ? ? -100.64 45.94 31 14 ILE A 37 ? ? -35.65 -37.86 32 14 LEU A 51 ? ? -47.91 160.77 33 14 LYS A 78 ? ? -86.29 37.58 34 14 SER A 79 ? ? -122.42 -53.84 35 14 LYS A 80 ? ? 33.30 50.05 36 15 ARG A 12 ? ? -34.82 146.50 37 16 ASN A 8 ? ? -105.93 -60.85 38 16 ARG A 12 ? ? -34.55 143.56 39 17 SER A 5 ? ? -37.57 131.95 40 17 ASN A 8 ? ? -62.30 95.74 41 17 ILE A 35 ? ? -41.35 150.23 42 17 ILE A 37 ? ? -37.37 -39.18 43 17 SER A 79 ? ? 35.50 31.47 44 17 LYS A 80 ? ? -51.98 171.77 45 18 SER A 6 ? ? -38.68 133.84 46 18 SER A 79 ? ? -64.08 94.49 47 19 PRO A 14 ? ? -69.74 -170.79 48 19 LYS A 78 ? ? -90.84 47.96 49 20 ASN A 8 ? ? -131.28 -54.90 50 20 ILE A 37 ? ? -36.67 -37.09 51 20 LEU A 51 ? ? -48.41 156.53 #